Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_714081 858 bp mRNA linear PLN 18-APR-2022 (CAALFM_C603260WA), partial mRNA. ACCESSION XM_714081 VERSION XM_714081.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 858) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 858) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 858) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 858) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 858) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 858) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_714081.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..858 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>858 /locus_tag="CAALFM_C603260WA" /db_xref="GeneID:3639183" CDS 1..858 /locus_tag="CAALFM_C603260WA" /note="Putative ribonuclease H1; possibly an essential gene, disruptants not obtained by UAU1 method; flow model biofilm induced; Spider biofilm induced" /codon_start=1 /transl_table=12 /product="RNA-DNA hybrid ribonuclease" /protein_id="XP_719174.2" /db_xref="CGD:CAL0000187941" /db_xref="GeneID:3639183" /translation="MPYYAVAKGSKTGVYSNWGDCKEQVHGYSGASYKKFSTAAEANA FVQSGGKSGSSSSYSSGGRSSGGISGSSRSSGGYSGGYSGGYSGGYSGGYSGGSSKRS SSSSTSSSSTTTNRVYVDGASRGNGQTSKAPSGYGVYYGPNDSRNVAVPLDRVDKNTS YKPTNQRAELHGVKHALKNIHNDLQSGKATGKTEIHSDSKYAIQSVNEWSSNWAKNGW KNSKGETVANKDLIQETVALKNSINKTYQDKNWGNLEFVHVKGHAGDPGNEAADRLAN QGADQYGKK" misc_feature 4..135 /locus_tag="CAALFM_C603260WA" /note="Caulimovirus viroplasmin; Region: Cauli_VI; pfam01693" /db_xref="CDD:460297" misc_feature 346..840 /locus_tag="CAALFM_C603260WA" /note="Eukaryotic RNase H is essential and is longer and more complex than their prokaryotic counterparts; Region: RNase_HI_eukaryote_like; cd09280" /db_xref="CDD:260012" misc_feature order(358..369,373..381,490..498,505..507,592..594, 598..603,679..684,772..774,781..783,826..828) /locus_tag="CAALFM_C603260WA" /note="RNA/DNA hybrid binding site [nucleotide binding]; other site" /db_xref="CDD:260012" ORIGIN 1 atgccatatt acgctgttgc taaaggatca aaaactggtg tatacagtaa ttggggtgat 61 tgtaaagaac aagtccacgg ttatagtggc gcatcttata agaaattcag tactgctgct 121 gaagccaatg cattcgtgca aagtgggggc aaatcaggat caagttcatc ttatagttcc 181 ggaggtagat catcaggtgg aatttctggt tctagtcgct catcaggtgg ttattctggt 241 ggttattccg gtggttattc cggtggctat tccggtggct actctggtgg tagctcaaag 301 cgttcttctt cctcttcaac atcttcttct tctactacta ctaatcgtgt ttatgttgat 361 ggtgcttcaa gaggaaatgg acaaaccagc aaggctccat caggatatgg tgtttattat 421 ggtcctaatg attcaagaaa tgttgctgtt cccttggata gagtagataa aaacacttca 481 tataaaccta caaatcaacg tgctgaatta catggtgtga aacatgcatt gaaaaatatc 541 cacaatgatt tacaactggg taaagctacg gggaaaaccg aaattcatag tgattcgaaa 601 tatgctattc aaagtgttaa tgaatggtcc agtaattggg caaagaatgg ttggaagaat 661 tccaaagggg aaactgttgc taataaagat ttgattcagg aaactgttgc attaaaaaat 721 agtattaaca aaacttatca agataaaaat tggggaaatt tggaatttgt tcatgttaaa 781 ggtcatgctg gtgatcctgg taatgaagct gctgatagat tggcaaatca aggagctgat 841 caatatggca agaagtag