Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 methylglyoxal reductase (NADPH-dependent)


LOCUS       XM_714079               1032 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C603240WA), partial mRNA.
ACCESSION   XM_714079
VERSION     XM_714079.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1032)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1032)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1032)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1032)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1032)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1032)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_714079.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1032
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1032
                     /locus_tag="CAALFM_C603240WA"
                     /db_xref="GeneID:3639181"
     CDS             1..1032
                     /locus_tag="CAALFM_C603240WA"
                     /note="Predicted 3-methylbutanol:NAD(P) oxidoreductase and
                     methylglyoxal reductase (NADPH-dependent); role in
                     ergosterol metabolic process; early stage flow model
                     biofilm induced; Spider biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="methylglyoxal reductase (NADPH-dependent)"
                     /protein_id="XP_719172.1"
                     /db_xref="CGD:CAL0000179051"
                     /db_xref="GeneID:3639181"
                     /translation="MSTPITVIVSGATGFIAQHVVKQLLAKNYQVIGTVRSTAKGDHL
                     LKLFNNPQNLSYEIVEDVGTKGAFDKVLQKHGEAKVFLHLASPFHFNVTDVEKELLLP
                     AVDGTKNVLQAIYNFGNNIEKVVITSSYAAISTASKEADKNAIITEKDWNEISWQDAL
                     LNPVNGYRGSKKFAEKAAWDFIKSNDNVKFSLSTINPSFVFGPQSFGSEIKQSLNTSS
                     EIINSILKLKPNDSIPASKGGWVDVRDVAKAHIIAFENEDAKNQRILLNSGRFTSQSL
                     VDIINDKFPDLKGKIPVDEPGSDKSVIAESLATIDDTKSRELLGFEYYNLEQSVYDTV
                     EQIVNAHKL"
     misc_feature    16..960
                     /locus_tag="CAALFM_C603240WA"
                     /note="aldehyde reductase, extended (e) SDRs; Region:
                     AR_SDR_e; cd05227"
                     /db_xref="CDD:187538"
     misc_feature    order(31..33,37..48,106..108,184..186,250..264,379..387,
                     499..501,511..513,589..600,646..651)
                     /locus_tag="CAALFM_C603240WA"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187538"
     misc_feature    order(262..264,268..270,385..393,400..402,499..501,
                     589..597,658..660,694..696,715..717,928..930)
                     /locus_tag="CAALFM_C603240WA"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187538"
     misc_feature    order(385..387,499..501,511..513)
                     /locus_tag="CAALFM_C603240WA"
                     /note="active site"
                     /db_xref="CDD:187538"
ORIGIN      
        1 atgtcaacac caattactgt tattgtttct ggagccacag gatttattgc tcaacacgtt
       61 gttaaacaat tattagctaa aaactatcaa gtcattggta cagttagatc aacagccaaa
      121 ggtgatcatt tattaaaatt attcaacaat ccacaaaact tatcttatga aattgttgaa
      181 gatgttggaa ctaaaggtgc ctttgataaa gtattacaaa aacatggaga agcaaaagtg
      241 ttcttacatt tagcttcacc attccatttt aatgtgactg atgttgaaaa agaattgtta
      301 ttgcctgctg ttgatggtac aaaaaatgta ttacaagcaa tttataattt tggtaacaat
      361 attgaaaaag tggttatcac ttcatcttat gctgccatta gtaccgcttc taaagaagct
      421 gataaaaatg caattattac agaaaaggat tggaatgaaa tcagttggca agatgcttta
      481 cttaatccag ttaatggata tcgtggatcc aaaaaatttg ctgaaaaagc tgcttgggat
      541 tttataaaat ctaatgataa tgttaaattt tcattgtcga caattaatcc atcatttgta
      601 tttggtccac aatcatttgg ttcagaaatt aaacaaagtt taaacacttc tagtgaaatc
      661 attaattcta ttttgaaatt gaaaccaaat gattcaattc ctgcgtcaaa aggaggttgg
      721 gttgatgtaa gagatgttgc caaagctcat atcattgcct ttgaaaatga ggatgccaaa
      781 aatcaaagaa tattgttgaa ttcaggtaga tttacatctc aatcacttgt tgatattatt
      841 aatgataaat ttccagattt gaaagggaaa ataccagttg atgaaccagg ttcagataaa
      901 tctgttattg ctgaaagttt ggctactatt gatgatacca aatctcgtga attattagga
      961 tttgaatatt ataaccttga acaatcagtt tatgatactg ttgaacaaat tgttaatgct
     1021 cataagttgt aa