Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_714079 1032 bp mRNA linear PLN 18-APR-2022 (CAALFM_C603240WA), partial mRNA. ACCESSION XM_714079 VERSION XM_714079.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1032) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1032) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1032) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1032) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1032) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1032) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_714079.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1032 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1032 /locus_tag="CAALFM_C603240WA" /db_xref="GeneID:3639181" CDS 1..1032 /locus_tag="CAALFM_C603240WA" /note="Predicted 3-methylbutanol:NAD(P) oxidoreductase and methylglyoxal reductase (NADPH-dependent); role in ergosterol metabolic process; early stage flow model biofilm induced; Spider biofilm induced" /codon_start=1 /transl_table=12 /product="methylglyoxal reductase (NADPH-dependent)" /protein_id="XP_719172.1" /db_xref="CGD:CAL0000179051" /db_xref="GeneID:3639181" /translation="MSTPITVIVSGATGFIAQHVVKQLLAKNYQVIGTVRSTAKGDHL LKLFNNPQNLSYEIVEDVGTKGAFDKVLQKHGEAKVFLHLASPFHFNVTDVEKELLLP AVDGTKNVLQAIYNFGNNIEKVVITSSYAAISTASKEADKNAIITEKDWNEISWQDAL LNPVNGYRGSKKFAEKAAWDFIKSNDNVKFSLSTINPSFVFGPQSFGSEIKQSLNTSS EIINSILKLKPNDSIPASKGGWVDVRDVAKAHIIAFENEDAKNQRILLNSGRFTSQSL VDIINDKFPDLKGKIPVDEPGSDKSVIAESLATIDDTKSRELLGFEYYNLEQSVYDTV EQIVNAHKL" misc_feature 16..960 /locus_tag="CAALFM_C603240WA" /note="aldehyde reductase, extended (e) SDRs; Region: AR_SDR_e; cd05227" /db_xref="CDD:187538" misc_feature order(31..33,37..48,106..108,184..186,250..264,379..387, 499..501,511..513,589..600,646..651) /locus_tag="CAALFM_C603240WA" /note="NADP binding site [chemical binding]; other site" /db_xref="CDD:187538" misc_feature order(262..264,268..270,385..393,400..402,499..501, 589..597,658..660,694..696,715..717,928..930) /locus_tag="CAALFM_C603240WA" /note="putative substrate binding site [chemical binding]; other site" /db_xref="CDD:187538" misc_feature order(385..387,499..501,511..513) /locus_tag="CAALFM_C603240WA" /note="active site" /db_xref="CDD:187538" ORIGIN 1 atgtcaacac caattactgt tattgtttct ggagccacag gatttattgc tcaacacgtt 61 gttaaacaat tattagctaa aaactatcaa gtcattggta cagttagatc aacagccaaa 121 ggtgatcatt tattaaaatt attcaacaat ccacaaaact tatcttatga aattgttgaa 181 gatgttggaa ctaaaggtgc ctttgataaa gtattacaaa aacatggaga agcaaaagtg 241 ttcttacatt tagcttcacc attccatttt aatgtgactg atgttgaaaa agaattgtta 301 ttgcctgctg ttgatggtac aaaaaatgta ttacaagcaa tttataattt tggtaacaat 361 attgaaaaag tggttatcac ttcatcttat gctgccatta gtaccgcttc taaagaagct 421 gataaaaatg caattattac agaaaaggat tggaatgaaa tcagttggca agatgcttta 481 cttaatccag ttaatggata tcgtggatcc aaaaaatttg ctgaaaaagc tgcttgggat 541 tttataaaat ctaatgataa tgttaaattt tcattgtcga caattaatcc atcatttgta 601 tttggtccac aatcatttgg ttcagaaatt aaacaaagtt taaacacttc tagtgaaatc 661 attaattcta ttttgaaatt gaaaccaaat gattcaattc ctgcgtcaaa aggaggttgg 721 gttgatgtaa gagatgttgc caaagctcat atcattgcct ttgaaaatga ggatgccaaa 781 aatcaaagaa tattgttgaa ttcaggtaga tttacatctc aatcacttgt tgatattatt 841 aatgataaat ttccagattt gaaagggaaa ataccagttg atgaaccagg ttcagataaa 901 tctgttattg ctgaaagttt ggctactatt gatgatacca aatctcgtga attattagga 961 tttgaatatt ataaccttga acaatcagtt tatgatactg ttgaacaaat tgttaatgct 1021 cataagttgt aa