Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Rnh1p (RNH1), partial mRNA.


LOCUS       XM_714032                702 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_714032
VERSION     XM_714032.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 702)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 702)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 702)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 702)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 702)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 702)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..702
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>702
                     /gene="RNH1"
                     /locus_tag="CAALFM_C602870WA"
                     /db_xref="GeneID:3639237"
     CDS             1..702
                     /gene="RNH1"
                     /locus_tag="CAALFM_C602870WA"
                     /note="Ribonuclease H (RNAse H); hyphal-induced;
                     flucytosine induced; similar to orf19.5564 (see Locus
                     History); possibly essential (UAU1 method); rat catheter
                     biofilm induced; flow model biofilm repressed"
                     /codon_start=1
                     /transl_table=12
                     /product="Rnh1p"
                     /protein_id="XP_719125.1"
                     /db_xref="CGD:CAL0000191701"
                     /db_xref="GeneID:3639237"
                     /translation="MPYYAVVNGREEGVFSSWQDCRPHVFAYKGAHFRKFENRNEAEE
                     YYQNDGDYFIYPIYVDGACRYNGCPHAEAGYGVYYGDGDSRNVSVPLDDVDPDGIIPT
                     NQRAELWAMNHALRNIWNELQEDTEDGKAVIYSDSIYAIKCLTKWPNKWTQNGWLNVH
                     GQTISNYDLVTKNYELYEWINDEYDDRGWGELDLIHVKGHSGNDGNEEADNLANLAAD
                     RYGYQSSSSSSGSYY"
     misc_feature    4..135
                     /gene="RNH1"
                     /locus_tag="CAALFM_C602870WA"
                     /note="Caulimovirus viroplasmin; Region: Cauli_VI;
                     pfam01693"
                     /db_xref="CDD:460297"
     misc_feature    169..654
                     /gene="RNH1"
                     /locus_tag="CAALFM_C602870WA"
                     /note="Eukaryotic RNase H is essential and is longer and
                     more complex than their prokaryotic counterparts; Region:
                     RNase_HI_eukaryote_like; cd09280"
                     /db_xref="CDD:260012"
     misc_feature    order(178..189,193..201,304..312,319..321,406..408,
                     412..417,493..498,586..588,595..597,640..642)
                     /gene="RNH1"
                     /locus_tag="CAALFM_C602870WA"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:260012"
ORIGIN      
        1 atgccatatt acgcagttgt taatggtcgt gaagaagggg ttttctctag ctggcaagat
       61 tgtcgaccac acgtctttgc ttataaaggt gcccattttc gtaaatttga aaatagaaat
      121 gaggcagaag aatattatca aaatgacgga gattatttca tctatccaat atatgttgat
      181 ggtgcttgta gatataatgg ttgcccacat gcagaagctg gatatggggt ttattatgga
      241 gatggtgatt caagaaacgt gtcagtacca ttggatgacg ttgatcctga tggaattatt
      301 ccaactaatc aacgagctga actttgggca atgaaccatg ccttgagaaa catttggaat
      361 gaactacagg aagatactga agatggtaag gctgttattt atagtgattc gatttatgcc
      421 atcaaatgtc ttacaaagtg gcctaacaaa tggacacaaa atggttggtt aaatgttcat
      481 ggtcaaacaa tttccaatta tgatttggtt actaaaaact atgagttata tgagtggatt
      541 aatgatgaat atgatgatag gggttgggga gaattggatt taattcatgt taaaggacat
      601 tcaggaaacg atggaaatga agaagcagat aatctagcaa acttggctgc tgatagatat
      661 ggctatcagt ccagttcatc gtcatctggt tcttattact ga