Candida albicans SC5314 NADP-dependent alcohol dehydrogenase

LOCUS       XM_713989               1110 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C602480WA), partial mRNA.
ACCESSION   XM_713989
VERSION     XM_713989.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1110)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1110)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1110)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1110)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1110)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1110)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1110
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1110
                     /locus_tag="CAALFM_C602480WA"
                     /db_xref="GeneID:3639170"
     CDS             1..1110
                     /locus_tag="CAALFM_C602480WA"
                     /note="Similar to alcohol dehydrogenases; induced by
                     benomyl treatment, nitric oxide; induced in core stress
                     response; oxidative stress-induced via Cap1; Spider
                     biofilm repressed"
                     /codon_start=1
                     /transl_table=12
                     /product="NADP-dependent alcohol dehydrogenase"
                     /protein_id="XP_719082.1"
                     /db_xref="CGD:CAL0000187810"
                     /db_xref="GeneID:3639170"
                     /translation="MTTDSVPAKFQGFASSNKNTWNKPKLVSYDRKQINPHDVVLENE
                     VCGLCYSDIHTLQSNWGEYNRDDLVVGHEIVGKVIAVGDKVTEFKIGQRVGIGAASSA
                     CRECNRCKSDNEQYCAKAASTYNAPDVRSNNYVTQGGYSSHSIADEQFVFPIPDDLPS
                     AYAAPLMCAGITVFSPLLRNLGSDAKGKTVGIIGIGGLGHLALQLAKALGAKVVAFSR
                     TSSKKDQALKLGADEFIATNEEKDWSSKYHDTFDFILNCASGVDGLNLQDYLSVLKVD
                     KKFISVGLPPATEQFGVSPFTFLKHGASFGSSLLGSKVEVLEMLKLAAKHNVKPWIEE
                     VPLSEENCSKALNRCHDGDVRYRFVFTEFDKAFAK"
     misc_feature    31..1083
                     /locus_tag="CAALFM_C602480WA"
                     /note="Cinnamyl alcohol dehydrogenases (CAD); Region:
                     CAD1; cd05283"
                     /db_xref="CDD:176186"
     misc_feature    order(145..153,160..162,502..504,514..516,580..597,
                     649..654,664..666,709..711,769..774,778..780,844..849,
                     922..930)
                     /locus_tag="CAALFM_C602480WA"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176186"
     misc_feature    order(145..147,151..153,214..216,292..294,502..504,
                     928..930)
                     /locus_tag="CAALFM_C602480WA"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176186"
     misc_feature    order(145..147,214..216,502..504)
                     /locus_tag="CAALFM_C602480WA"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176186"
     misc_feature    order(307..309,316..318,325..327,349..351)
                     /locus_tag="CAALFM_C602480WA"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176186"
     misc_feature    order(346..348,523..525,535..537,826..828,841..849,
                     853..855,886..888,892..897,904..927)
                     /locus_tag="CAALFM_C602480WA"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176186"
ORIGIN      
        1 atgactaccg attcagttcc agctaaattt caaggttttg cttcctctaa caagaatact
       61 tggaataaac caaaattagt ttcttatgat agaaaacaaa tcaatcctca tgatgttgtt
      121 cttgaaaatg aagtttgtgg attatgttat tctgatattc atactttaca atccaattgg
      181 ggtgaataca atcgtgatga tttagttgtt ggtcatgaaa ttgttggtaa agtcattgct
      241 gttggtgata aagtcaccga attcaaaatt ggtcaacgtg ttggtattgg tgctgcttca
      301 tctgcttgtc gtgaatgtaa tagatgtaag tctgataatg agcaatattg tgctaaagct
      361 gctagtactt ataatgctcc tgatgtcaga tctaataatt atgtcactca aggtggttat
      421 tcatctcatt caattgctga tgaacaattt gttttcccaa ttccagatga tttaccaagt
      481 gcttatgctg ccccattgat gtgtgctggt atcactgttt tctccccatt gttacgtaac
      541 ttgggtagtg atgccaaagg taaaactgtt ggtattattg gtattggtgg tttaggtcat
      601 ttggccttgc aattggctaa agctttaggt gctaaggttg ttgccttttc aagaacctca
      661 agtaaaaaag accaagcttt gaaattgggt gctgatgaat tcattgctac taatgaagaa
      721 aaagattggt caagcaaata ccatgacact tttgatttca tcttgaattg tgcttcaggt
      781 gttgatggat taaacttgca agattatttg agtgttttga aagtcgataa gaaatttatt
      841 tctgttggtt taccaccagc cactgaacaa tttggtgttt caccattcac tttcttgaaa
      901 catggtgctt cttttggttc ttcattattg ggatctaaag ttgaagtatt ggaaatgttg
      961 aaattggctg ctaaacacaa tgtgaaacca tggattgaag aagttccact cagtgaagaa
     1021 aactgttcta aagctttgaa cagatgtcat gatggtgatg ttagatacag atttgtgttt
     1081 actgaatttg ataaagcttt tgcaaagtaa