Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Sap1p (SAP1), partial mRNA.


LOCUS       XM_712960               1176 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_712960
VERSION     XM_712960.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1176)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1176)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1176)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1176)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1176)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1176)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_712960.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1176
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1176
                     /gene="SAP1"
                     /locus_tag="CAALFM_C603490CA"
                     /db_xref="GeneID:3640256"
     CDS             1..1176
                     /gene="SAP1"
                     /locus_tag="CAALFM_C603490CA"
                     /note="Secreted aspartyl proteinase; acts in utilization
                     of protein as nitrogen source; assessment of virulence
                     role complicated by URA3 effects; regulated by growth
                     phase, alpha-pheromone; produced by opaque cells"
                     /codon_start=1
                     /transl_table=12
                     /product="Sap1p"
                     /protein_id="XP_718053.2"
                     /db_xref="CGD:CAL0000189556"
                     /db_xref="GeneID:3640256"
                     /translation="MFLKNIFIALAIALLVDASPAKRSPGFVTLDFDVIKTPVNATGQ
                     EGKVKRQAIPVTLNNEHVSYAADITIGSNKQKFNVIVDTGSSDLWVPDASVTCDKPRP
                     GQSADFCKGKGIYTPKSSTTSQNLGTPFYIGYGDGSSSQGTLYKDTVGFGGASITKQV
                     FADITKTSIPQGILGIGYKTNEAAGDYDNVPVTLKNQGVIAKNAYSLYLNSPNAATGQ
                     IIFGGVDKAKYSGSLIAVPVTSDRELRITLNSLKAVGKNINGNIDVLLDSGTTITYLQ
                     QDVAQDIIDAFQAELKSDGQGHTFYVTDCQTSGTVDFNFDNNAKISVPASEFTAPLSY
                     ANGQPYPKCQLLLGISDANILGDNFLRSAYLVYDLDDDKISLAQVKYTSASNIAALT"
     misc_feature    184..1137
                     /gene="SAP1"
                     /locus_tag="CAALFM_C603490CA"
                     /note="SAPs, pepsin-like proteinases secreted from
                     pathogens to degrade host proteins; Region: SAP_like;
                     cd05474"
                     /db_xref="CDD:133141"
     misc_feature    order(187..189,388..390,397..399,412..414,430..432,
                     535..537,1042..1044,1054..1056)
                     /gene="SAP1"
                     /locus_tag="CAALFM_C603490CA"
                     /note="inhibitor binding site [active]"
                     /db_xref="CDD:133141"
     misc_feature    order(244..255,799..810)
                     /gene="SAP1"
                     /locus_tag="CAALFM_C603490CA"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:133141"
     misc_feature    order(244..246,799..801)
                     /gene="SAP1"
                     /locus_tag="CAALFM_C603490CA"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:133141"
     misc_feature    order(391..408,412..426)
                     /gene="SAP1"
                     /locus_tag="CAALFM_C603490CA"
                     /note="Active site flap [active]"
                     /db_xref="CDD:133141"
ORIGIN      
        1 atgtttttaa agaatatttt tattgctctt gctattgctt tattagttga tgcttctcca
       61 gctaaaagat ccccaggttt tgtcacttta gactttgatg tcattaaaac tcctgttaat
      121 gctactggtc aagaaggtaa agttaaaaga caagccattc cagttacttt aaataatgaa
      181 cacgttagtt atgctgctga catcactatt ggttccaata aacaaaagtt taatgttatt
      241 gttgatactg gatcttctga tttatgggtt cctgatgctt ctgttacttg tgataaacct
      301 cgtcctggtc aatcagcaga tttctgtaaa gggaaaggta tttacactcc aaaatcttct
      361 accacttctc aaaatttggg tactccattc tatattggtt atggtgatgg tagttcctct
      421 caaggcactt tgtataaaga tactgttggt tttggtggtg cttcaatcac aaagcaagtc
      481 tttgccgata tcaccaagac ttctattcct caagggattt taggtattgg ttataaaacc
      541 aatgaggctg ctggtgatta tgataatgtt ccagttactt tgaagaacca aggagttatt
      601 gccaagaatg cttattcact ttatctcaac tctcccaatg ctgccactgg acaaatcatt
      661 tttggtgggg ttgacaaagc taaatacagt ggttcattga ttgctgttcc tgtcacttct
      721 gatagagaat taagaatcac tttgaattct ctcaaagctg ttggcaaaaa tatcaatggt
      781 aatatcgatg ttcttttaga ttctggtacc acaattactt atcttcaaca agatgttgct
      841 caagatatta ttgatgcctt ccaagctgaa ttgaaactgg acggtcaagg tcatactttc
      901 tatgttactg attgtcaaac ttctggaact gttgatttca attttgacaa caacgccaag
      961 atttctgttc cagcttctga gtttactgct ccgttgagct acgctaacgg tcaaccttat
     1021 ccaaaatgtc aacttctttt aggtattagt gatgctaata ttcttggtga taactttttg
     1081 agatcagctt accttgttta tgatttggat gatgataaaa tttctttagc tcaagttaaa
     1141 tacacttctg cttcaaacat tgctgctctt acctag