Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_712960 1176 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_712960 VERSION XM_712960.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1176) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1176) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1176) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1176) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1176) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1176) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_712960.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1176 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1176 /gene="SAP1" /locus_tag="CAALFM_C603490CA" /db_xref="GeneID:3640256" CDS 1..1176 /gene="SAP1" /locus_tag="CAALFM_C603490CA" /note="Secreted aspartyl proteinase; acts in utilization of protein as nitrogen source; assessment of virulence role complicated by URA3 effects; regulated by growth phase, alpha-pheromone; produced by opaque cells" /codon_start=1 /transl_table=12 /product="Sap1p" /protein_id="XP_718053.2" /db_xref="CGD:CAL0000189556" /db_xref="GeneID:3640256" /translation="MFLKNIFIALAIALLVDASPAKRSPGFVTLDFDVIKTPVNATGQ EGKVKRQAIPVTLNNEHVSYAADITIGSNKQKFNVIVDTGSSDLWVPDASVTCDKPRP GQSADFCKGKGIYTPKSSTTSQNLGTPFYIGYGDGSSSQGTLYKDTVGFGGASITKQV FADITKTSIPQGILGIGYKTNEAAGDYDNVPVTLKNQGVIAKNAYSLYLNSPNAATGQ IIFGGVDKAKYSGSLIAVPVTSDRELRITLNSLKAVGKNINGNIDVLLDSGTTITYLQ QDVAQDIIDAFQAELKSDGQGHTFYVTDCQTSGTVDFNFDNNAKISVPASEFTAPLSY ANGQPYPKCQLLLGISDANILGDNFLRSAYLVYDLDDDKISLAQVKYTSASNIAALT" misc_feature 184..1137 /gene="SAP1" /locus_tag="CAALFM_C603490CA" /note="SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins; Region: SAP_like; cd05474" /db_xref="CDD:133141" misc_feature order(187..189,388..390,397..399,412..414,430..432, 535..537,1042..1044,1054..1056) /gene="SAP1" /locus_tag="CAALFM_C603490CA" /note="inhibitor binding site [active]" /db_xref="CDD:133141" misc_feature order(244..255,799..810) /gene="SAP1" /locus_tag="CAALFM_C603490CA" /note="catalytic motif [active]" /db_xref="CDD:133141" misc_feature order(244..246,799..801) /gene="SAP1" /locus_tag="CAALFM_C603490CA" /note="catalytic residue [active]" /db_xref="CDD:133141" misc_feature order(391..408,412..426) /gene="SAP1" /locus_tag="CAALFM_C603490CA" /note="Active site flap [active]" /db_xref="CDD:133141" ORIGIN 1 atgtttttaa agaatatttt tattgctctt gctattgctt tattagttga tgcttctcca 61 gctaaaagat ccccaggttt tgtcacttta gactttgatg tcattaaaac tcctgttaat 121 gctactggtc aagaaggtaa agttaaaaga caagccattc cagttacttt aaataatgaa 181 cacgttagtt atgctgctga catcactatt ggttccaata aacaaaagtt taatgttatt 241 gttgatactg gatcttctga tttatgggtt cctgatgctt ctgttacttg tgataaacct 301 cgtcctggtc aatcagcaga tttctgtaaa gggaaaggta tttacactcc aaaatcttct 361 accacttctc aaaatttggg tactccattc tatattggtt atggtgatgg tagttcctct 421 caaggcactt tgtataaaga tactgttggt tttggtggtg cttcaatcac aaagcaagtc 481 tttgccgata tcaccaagac ttctattcct caagggattt taggtattgg ttataaaacc 541 aatgaggctg ctggtgatta tgataatgtt ccagttactt tgaagaacca aggagttatt 601 gccaagaatg cttattcact ttatctcaac tctcccaatg ctgccactgg acaaatcatt 661 tttggtgggg ttgacaaagc taaatacagt ggttcattga ttgctgttcc tgtcacttct 721 gatagagaat taagaatcac tttgaattct ctcaaagctg ttggcaaaaa tatcaatggt 781 aatatcgatg ttcttttaga ttctggtacc acaattactt atcttcaaca agatgttgct 841 caagatatta ttgatgcctt ccaagctgaa ttgaaactgg acggtcaagg tcatactttc 901 tatgttactg attgtcaaac ttctggaact gttgatttca attttgacaa caacgccaag 961 atttctgttc cagcttctga gtttactgct ccgttgagct acgctaacgg tcaaccttat 1021 ccaaaatgtc aacttctttt aggtattagt gatgctaata ttcttggtga taactttttg 1081 agatcagctt accttgttta tgatttggat gatgataaaa tttctttagc tcaagttaaa 1141 tacacttctg cttcaaacat tgctgctctt acctag