Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 putative pyridoxal kinase


LOCUS       XM_711627                888 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C601750CA), partial mRNA.
ACCESSION   XM_711627
VERSION     XM_711627.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 888)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 888)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 888)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 888)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 888)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 888)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_711627.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..888
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>888
                     /locus_tag="CAALFM_C601750CA"
                     /db_xref="GeneID:3641640"
     CDS             1..888
                     /locus_tag="CAALFM_C601750CA"
                     /note="Ortholog(s) have role in cellular bud site
                     selection and cytosol, nucleus localization"
                     /codon_start=1
                     /transl_table=12
                     /product="putative pyridoxal kinase"
                     /protein_id="XP_716720.1"
                     /db_xref="CGD:CAL0000178296"
                     /db_xref="GeneID:3641640"
                     /translation="MKSLLSISSHVVHGYVGNRATVFPLQYAGWDVDAINTTNFSNHP
                     GYGSLSGTASPPEAIQDIILGLKQILDFNNVYDIILTGYTPNAEVLQILKSEIEQAIT
                     NSRNKPHWIVDPVLGDNGKLYVKENLIPVYRDIFASGLVELTTPNQFEFETLSGVKIV
                     DWSTAKDAIYEFRKLYKVKNIVISSVSIDDHLYCVGSSNDRIFYISIEQIGCSFNGCG
                     DLFTALLADEFYNGEYVLSPQMLSKVLYKLHKILEFSYDDIFKRIGQIPTVVKDIRVV
                     AAKEFLTSDYKLDTDVIYL"
     misc_feature    7..771
                     /locus_tag="CAALFM_C601750CA"
                     /note="Pyridoxal kinase plays a key role in the synthesis
                     of the active coenzyme pyridoxal-5'-phosphate (PLP), by
                     catalyzing the phosphorylation of the precursor vitamin B6
                     in the presence of Zn2+ and ATP. Mammals are unable to
                     synthesize PLP de novo and...; Region:
                     pyridoxal_pyridoxamine_kinase; cd01173"
                     /db_xref="CDD:238578"
     misc_feature    order(7..9,28..30,34..39,43..45,55..57,67..69,76..78,
                     91..108,115..117,124..126,151..156,160..162,181..186,
                     205..207)
                     /locus_tag="CAALFM_C601750CA"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238578"
     misc_feature    order(25..27,46..51,118..120,127..132,145..147,247..249,
                     253..255,643..648,655..657)
                     /locus_tag="CAALFM_C601750CA"
                     /note="pyridoxal binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238578"
     misc_feature    order(337..339,352..354,433..435,439..441,448..450,
                     550..555,574..576,619..621,625..630,640..642,649..657,
                     661..663,742..744,754..756)
                     /locus_tag="CAALFM_C601750CA"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238578"
ORIGIN      
        1 atgaagtcac tattatctat tctgtcacat gttgtacatg gatatgtggg aaacagggcc
       61 acagttttcc ccttgcagta tgctgggtgg gatgtcgatg ccatcaacac taccaatttt
      121 tctaatcatc ctggatatgg atcattgagt gggaccgcat caccaccaga ggccatacaa
      181 gatataattt tgggactaaa acagatcctt gatttcaata atgtgtacga tataatcctt
      241 acaggatata cacccaatgc tgaagttcta cagatactaa agagtgaaat tgaacaagcc
      301 attaccaact cccgcaacaa acctcattgg atagttgatc ctgtattagg agataatggt
      361 aaactatacg tcaaagaaaa cttgataccg gtttatcgtg acatatttgc cagtggatta
      421 gtggagctta ccacgcctaa tcaattcgaa tttgaaacat taagtggtgt gaaaattgtt
      481 gattggtcaa ctgctaaaga tgcaatttat gagtttcgta aactctataa ggttaagaat
      541 attgtgatat cctcagtatc aattgatgac catttgtatt gtgttgggtc ttccaatgac
      601 agaatttttt atatttctat tgaacaaatt ggatgcagtt tcaatggttg tggggattta
      661 tttactgcat tacttgcaga cgaattttac aatggggagt atgtgttaag tccacagatg
      721 ttatcgaaag tactttacaa attacacaag atcttagagt ttagctacga tgatattttt
      781 aaacgtatcg gacaaattcc aacagtggtg aaggatataa gagttgtggc agctaaagaa
      841 tttcttacat ctgattataa gctagacact gatgtaatat atttatag