Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_711627 888 bp mRNA linear PLN 18-APR-2022 (CAALFM_C601750CA), partial mRNA. ACCESSION XM_711627 VERSION XM_711627.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 888) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 888) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 888) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 888) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 888) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 888) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_711627.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..888 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>888 /locus_tag="CAALFM_C601750CA" /db_xref="GeneID:3641640" CDS 1..888 /locus_tag="CAALFM_C601750CA" /note="Ortholog(s) have role in cellular bud site selection and cytosol, nucleus localization" /codon_start=1 /transl_table=12 /product="putative pyridoxal kinase" /protein_id="XP_716720.1" /db_xref="CGD:CAL0000178296" /db_xref="GeneID:3641640" /translation="MKSLLSISSHVVHGYVGNRATVFPLQYAGWDVDAINTTNFSNHP GYGSLSGTASPPEAIQDIILGLKQILDFNNVYDIILTGYTPNAEVLQILKSEIEQAIT NSRNKPHWIVDPVLGDNGKLYVKENLIPVYRDIFASGLVELTTPNQFEFETLSGVKIV DWSTAKDAIYEFRKLYKVKNIVISSVSIDDHLYCVGSSNDRIFYISIEQIGCSFNGCG DLFTALLADEFYNGEYVLSPQMLSKVLYKLHKILEFSYDDIFKRIGQIPTVVKDIRVV AAKEFLTSDYKLDTDVIYL" misc_feature 7..771 /locus_tag="CAALFM_C601750CA" /note="Pyridoxal kinase plays a key role in the synthesis of the active coenzyme pyridoxal-5'-phosphate (PLP), by catalyzing the phosphorylation of the precursor vitamin B6 in the presence of Zn2+ and ATP. Mammals are unable to synthesize PLP de novo and...; Region: pyridoxal_pyridoxamine_kinase; cd01173" /db_xref="CDD:238578" misc_feature order(7..9,28..30,34..39,43..45,55..57,67..69,76..78, 91..108,115..117,124..126,151..156,160..162,181..186, 205..207) /locus_tag="CAALFM_C601750CA" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:238578" misc_feature order(25..27,46..51,118..120,127..132,145..147,247..249, 253..255,643..648,655..657) /locus_tag="CAALFM_C601750CA" /note="pyridoxal binding site [chemical binding]; other site" /db_xref="CDD:238578" misc_feature order(337..339,352..354,433..435,439..441,448..450, 550..555,574..576,619..621,625..630,640..642,649..657, 661..663,742..744,754..756) /locus_tag="CAALFM_C601750CA" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:238578" ORIGIN 1 atgaagtcac tattatctat tctgtcacat gttgtacatg gatatgtggg aaacagggcc 61 acagttttcc ccttgcagta tgctgggtgg gatgtcgatg ccatcaacac taccaatttt 121 tctaatcatc ctggatatgg atcattgagt gggaccgcat caccaccaga ggccatacaa 181 gatataattt tgggactaaa acagatcctt gatttcaata atgtgtacga tataatcctt 241 acaggatata cacccaatgc tgaagttcta cagatactaa agagtgaaat tgaacaagcc 301 attaccaact cccgcaacaa acctcattgg atagttgatc ctgtattagg agataatggt 361 aaactatacg tcaaagaaaa cttgataccg gtttatcgtg acatatttgc cagtggatta 421 gtggagctta ccacgcctaa tcaattcgaa tttgaaacat taagtggtgt gaaaattgtt 481 gattggtcaa ctgctaaaga tgcaatttat gagtttcgta aactctataa ggttaagaat 541 attgtgatat cctcagtatc aattgatgac catttgtatt gtgttgggtc ttccaatgac 601 agaatttttt atatttctat tgaacaaatt ggatgcagtt tcaatggttg tggggattta 661 tttactgcat tacttgcaga cgaattttac aatggggagt atgtgttaag tccacagatg 721 ttatcgaaag tactttacaa attacacaag atcttagagt ttagctacga tgatattttt 781 aaacgtatcg gacaaattcc aacagtggtg aaggatataa gagttgtggc agctaaagaa 841 tttcttacat ctgattataa gctagacact gatgtaatat atttatag