Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 serine/threonine/tyrosine protein kinase


LOCUS       XM_707406               1221 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C602190CA), partial mRNA.
ACCESSION   XM_707406
VERSION     XM_707406.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1221)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1221)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1221)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1221)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1221)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1221)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_707406.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1221
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1221
                     /locus_tag="CAALFM_C602190CA"
                     /db_xref="GeneID:3645862"
     CDS             1..1221
                     /locus_tag="CAALFM_C602190CA"
                     /note="Putative serine/threonine/tyrosine
                     (dual-specificity) kinase; disruptants not obtained by
                     UAU1 method"
                     /codon_start=1
                     /transl_table=12
                     /product="serine/threonine/tyrosine protein kinase"
                     /protein_id="XP_712499.1"
                     /db_xref="CGD:CAL0000199382"
                     /db_xref="GeneID:3645862"
                     /translation="MPQSSSTFINEYTLPDVVENSSSRASKMTIKEYKRIGEGAFGTV
                     VEAMLKYETNSSKGNDGTGSHLLGHFRHHSHSDKDNNNTTNNNNNNNKDGEWLGPFAI
                     KRVPAQTEYKSRELEILRFVSHPNIVSLRFFFDKKSSSDNKVYQNLVMECLPSNLQSE
                     IKYYRQSKYTIPYPHMKAYTFQLARAMLYLHGYGISHRDIKPSNILVDPNTVRLKICD
                     FGSAKKLEPNQPSVSYICSRYYRAPELIVGCSLYTTKIDIWGLGCVIAEMFLGKPIFQ
                     GQSPESQLKEIAKLLGPPPNTFFFKSNPQYRGNMYTTRLFNCSIEERFKQIFSNSPSD
                     AIDLLMKILVYDPDVRASPRRVLIHPFFDELKSSQFKVYPRGSSTPIELHLFNFSEYE
                     LELLGSLKNEFVKS"
     misc_feature    79..1095
                     /locus_tag="CAALFM_C602190CA"
                     /note="The catalytic domain of the Serine/Threonine
                     Kinase, Glycogen Synthase Kinase 3; Region: STKc_GSK3;
                     cd14137"
                     /db_xref="CDD:271039"
     misc_feature    order(106..120,130..132,301..303,307..309,340..342,
                     382..384,448..459,466..468,472..477,595..597,601..603,
                     607..612,616..618,652..654,661..663,694..696,700..711,
                     715..717,829..831)
                     /locus_tag="CAALFM_C602190CA"
                     /note="active site"
                     /db_xref="CDD:271039"
     misc_feature    order(106..117,130..132,301..303,307..309,382..384,
                     448..459,466..468,601..603,607..612,616..618,652..654)
                     /locus_tag="CAALFM_C602190CA"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:271039"
     misc_feature    order(118..123,688..714,736..741,832..846,850..855,
                     865..867,928..939)
                     /locus_tag="CAALFM_C602190CA"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:271039"
     misc_feature    order(340..342,472..474,595..597,601..603,661..663,
                     694..696,700..711,715..717,829..831)
                     /locus_tag="CAALFM_C602190CA"
                     /note="polypeptide substrate binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:271039"
     misc_feature    order(649..681,685..717)
                     /locus_tag="CAALFM_C602190CA"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:271039"
     misc_feature    order(736..738,841..846,850..855,862..867,928..945)
                     /locus_tag="CAALFM_C602190CA"
                     /note="axin binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:271039"
ORIGIN      
        1 atgcctcaat catcgtcaac ttttataaat gaatatactt tacctgatgt ggtggaaaat
       61 tcttcctcgc gtgccagtaa aatgacaatt aaagaataca agagaatagg agaaggtgca
      121 tttggtactg ttgttgaagc tatgttgaaa tatgaaacta attcgtctaa aggaaatgat
      181 ggcactgggt cacatttact tggccatttc cgtcatcata gccatagcga caaggataat
      241 aataatacaa ccaacaacaa caataataac aacaaagatg gtgaatggtt aggaccattt
      301 gctattaaac gagtccctgc acaaactgaa tataaatcac gagaattgga aattttacga
      361 tttgtcagcc atcctaatat tgtcagttta cgattttttt tcgataagaa aagttcttct
      421 gataataaag tttatcaaaa tttagtaatg gaatgtttac catcaaattt acaatcagaa
      481 atcaaatatt atcgtcaatc caaatacact attccatatc cccatatgaa agcttatact
      541 ttccaattgg ctcgagccat gctctattta cacggatatg gaatcagtca tcgagatatt
      601 aaaccatcaa atatacttgt tgatccaaac acggtgagat tgaaaatttg tgattttgga
      661 tctgcaaaaa aattagaacc aaatcaacct tcagtgagtt atatatgttc aagatattat
      721 cgtgctcctg aactaattgt tggatgttct ttatatacaa ccaaaattga tatatggggg
      781 ttaggatgtg ttattgcgga aatgttcttg ggtaaaccaa ttttccaagg tcaatcacct
      841 gaatctcaat tgaaagaaat tgctaaactt ttaggtccgc caccaaatac ttttttcttc
      901 aaaagtaatc ctcaatatcg tggtaatatg tatactacaa gattattcaa ttgtagtata
      961 gaagaaagat ttaaacaaat tttcagtaat tcaccactgg atgcaattga tttattgatg
     1021 aaaatattgg tttatgatcc tgatgtaaga gctagtccta gaagagtgtt gatacatcca
     1081 tttttcgatg aattgaaatc ttcacaattt aaagtttatc ctcgtgggtc atctactcca
     1141 attgaattgc atttatttaa ttttagtgaa tatgaattgg aattattggg atctttgaaa
     1201 aatgaatttg tgaaatcata a