Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707406 1221 bp mRNA linear PLN 18-APR-2022 (CAALFM_C602190CA), partial mRNA. ACCESSION XM_707406 VERSION XM_707406.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1221) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1221) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1221) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1221) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1221) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1221) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_707406.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1221 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1221 /locus_tag="CAALFM_C602190CA" /db_xref="GeneID:3645862" CDS 1..1221 /locus_tag="CAALFM_C602190CA" /note="Putative serine/threonine/tyrosine (dual-specificity) kinase; disruptants not obtained by UAU1 method" /codon_start=1 /transl_table=12 /product="serine/threonine/tyrosine protein kinase" /protein_id="XP_712499.1" /db_xref="CGD:CAL0000199382" /db_xref="GeneID:3645862" /translation="MPQSSSTFINEYTLPDVVENSSSRASKMTIKEYKRIGEGAFGTV VEAMLKYETNSSKGNDGTGSHLLGHFRHHSHSDKDNNNTTNNNNNNNKDGEWLGPFAI KRVPAQTEYKSRELEILRFVSHPNIVSLRFFFDKKSSSDNKVYQNLVMECLPSNLQSE IKYYRQSKYTIPYPHMKAYTFQLARAMLYLHGYGISHRDIKPSNILVDPNTVRLKICD FGSAKKLEPNQPSVSYICSRYYRAPELIVGCSLYTTKIDIWGLGCVIAEMFLGKPIFQ GQSPESQLKEIAKLLGPPPNTFFFKSNPQYRGNMYTTRLFNCSIEERFKQIFSNSPSD AIDLLMKILVYDPDVRASPRRVLIHPFFDELKSSQFKVYPRGSSTPIELHLFNFSEYE LELLGSLKNEFVKS" misc_feature 79..1095 /locus_tag="CAALFM_C602190CA" /note="The catalytic domain of the Serine/Threonine Kinase, Glycogen Synthase Kinase 3; Region: STKc_GSK3; cd14137" /db_xref="CDD:271039" misc_feature order(106..120,130..132,301..303,307..309,340..342, 382..384,448..459,466..468,472..477,595..597,601..603, 607..612,616..618,652..654,661..663,694..696,700..711, 715..717,829..831) /locus_tag="CAALFM_C602190CA" /note="active site" /db_xref="CDD:271039" misc_feature order(106..117,130..132,301..303,307..309,382..384, 448..459,466..468,601..603,607..612,616..618,652..654) /locus_tag="CAALFM_C602190CA" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:271039" misc_feature order(118..123,688..714,736..741,832..846,850..855, 865..867,928..939) /locus_tag="CAALFM_C602190CA" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:271039" misc_feature order(340..342,472..474,595..597,601..603,661..663, 694..696,700..711,715..717,829..831) /locus_tag="CAALFM_C602190CA" /note="polypeptide substrate binding site [polypeptide binding]; other site" /db_xref="CDD:271039" misc_feature order(649..681,685..717) /locus_tag="CAALFM_C602190CA" /note="activation loop (A-loop); other site" /db_xref="CDD:271039" misc_feature order(736..738,841..846,850..855,862..867,928..945) /locus_tag="CAALFM_C602190CA" /note="axin binding site [polypeptide binding]; other site" /db_xref="CDD:271039" ORIGIN 1 atgcctcaat catcgtcaac ttttataaat gaatatactt tacctgatgt ggtggaaaat 61 tcttcctcgc gtgccagtaa aatgacaatt aaagaataca agagaatagg agaaggtgca 121 tttggtactg ttgttgaagc tatgttgaaa tatgaaacta attcgtctaa aggaaatgat 181 ggcactgggt cacatttact tggccatttc cgtcatcata gccatagcga caaggataat 241 aataatacaa ccaacaacaa caataataac aacaaagatg gtgaatggtt aggaccattt 301 gctattaaac gagtccctgc acaaactgaa tataaatcac gagaattgga aattttacga 361 tttgtcagcc atcctaatat tgtcagttta cgattttttt tcgataagaa aagttcttct 421 gataataaag tttatcaaaa tttagtaatg gaatgtttac catcaaattt acaatcagaa 481 atcaaatatt atcgtcaatc caaatacact attccatatc cccatatgaa agcttatact 541 ttccaattgg ctcgagccat gctctattta cacggatatg gaatcagtca tcgagatatt 601 aaaccatcaa atatacttgt tgatccaaac acggtgagat tgaaaatttg tgattttgga 661 tctgcaaaaa aattagaacc aaatcaacct tcagtgagtt atatatgttc aagatattat 721 cgtgctcctg aactaattgt tggatgttct ttatatacaa ccaaaattga tatatggggg 781 ttaggatgtg ttattgcgga aatgttcttg ggtaaaccaa ttttccaagg tcaatcacct 841 gaatctcaat tgaaagaaat tgctaaactt ttaggtccgc caccaaatac ttttttcttc 901 aaaagtaatc ctcaatatcg tggtaatatg tatactacaa gattattcaa ttgtagtata 961 gaagaaagat ttaaacaaat tttcagtaat tcaccactgg atgcaattga tttattgatg 1021 aaaatattgg tttatgatcc tgatgtaaga gctagtccta gaagagtgtt gatacatcca 1081 tttttcgatg aattgaaatc ttcacaattt aaagtttatc ctcgtgggtc atctactcca 1141 attgaattgc atttatttaa ttttagtgaa tatgaattgg aattattggg atctttgaaa 1201 aatgaatttg tgaaatcata a