Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707338 747 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_707338 VERSION XM_707338.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 747) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 747) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 747) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 747) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 747) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 747) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_707338.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..747 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>747 /gene="NAG1" /locus_tag="CAALFM_C604590CA" /db_xref="GeneID:3645966" CDS 1..747 /gene="NAG1" /locus_tag="CAALFM_C604590CA" /note="Glucosamine-6-phosphate deaminase; required for normal hyphal growth and mouse virulence; converts glucosamine 6-P to fructose 6-P; reversible reaction in vitro; gene and protein is GlcNAc-induced; Spider biofilm induced" /codon_start=1 /transl_table=12 /product="Nag1p" /protein_id="XP_712431.2" /db_xref="CGD:CAL0000199480" /db_xref="GeneID:3645966" /translation="MRQAIFSNPNDAAEYLANYIIAKINSTPRTFVLGLPTGSSPEGI YAKLIEANKQGRVSFKNVVTFNMDEYLGLAPSDLQSYHYFMYDKFFNHIDIPRENIHI LNGLAANIDEECANYEKKIKQYGRIDLFLGGLGPEGHLAFNEAGSSRNSKTRKVELVE STIKANCRFFGNDESKVPKYALSVGISTILDNSDEIAIIVLGKNKQFALDKTVNGKPN DPKYPSSYLQDHANVLIVCDNAAAGLKSKL" misc_feature 31..732 /gene="NAG1" /locus_tag="CAALFM_C604590CA" /note="Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It...; Region: GlcN6P_deaminase; cd01399" /db_xref="CDD:238693" misc_feature order(109..120,199..204,397..402,415..417,421..423, 502..504,613..615) /gene="NAG1" /locus_tag="CAALFM_C604590CA" /note="active site" /db_xref="CDD:238693" misc_feature order(436..438,442..447,469..471,637..654,658..660, 682..690) /gene="NAG1" /locus_tag="CAALFM_C604590CA" /note="trimer interface [polypeptide binding]; other site" /db_xref="CDD:238693" misc_feature order(439..444,460..471) /gene="NAG1" /locus_tag="CAALFM_C604590CA" /note="allosteric site [active]" /db_xref="CDD:238693" misc_feature order(475..477,484..516,526..534) /gene="NAG1" /locus_tag="CAALFM_C604590CA" /note="active site lid [active]" /db_xref="CDD:238693" misc_feature order(490..492,607..609,619..621,715..717,724..732) /gene="NAG1" /locus_tag="CAALFM_C604590CA" /note="hexamer (dimer of trimers) interface [polypeptide binding]; other site" /db_xref="CDD:238693" ORIGIN 1 atgagacaag ctatattttc caaccctaac gatgctgctg agtatttggc aaactatatc 61 attgccaaaa tcaattccac tcccagaaca tttgttcttg gccttccaac cggatcatcc 121 cctgaaggca tttatgccaa attgatcgaa gccaacaagc aaggccgtgt tagtttcaag 181 aacgtcgtga ccttcaacat ggacgagtat ttgggattgg ccccatctga cttgcagtcg 241 taccattatt tcatgtacga caagtttttc aaccatatcg atatcccgcg tgaaaatatc 301 cacatcttga acggattggc cgcaaacatc gacgaggagt gtgccaacta cgaaaagaaa 361 atcaaacaat acggaagaat cgatttgttc ttaggtgggt tgggcccaga aggtcatttg 421 gcattcaacg aagcgggatc atcaagaaac tctaaaacaa gaaaggtcga gttggtcgaa 481 agtaccatca aggcaaactg caggtttttc gggaacgacg agagcaaggt ccctaaatat 541 gcattgagtg ttggcatttc caccatattg gacaactcag acgaaattgc cattatcgtg 601 ttgggcaaaa ataaacaatt tgcattggac aaaactgtaa acgggaaacc aaacgaccca 661 aaatacccat caagctattt acaagaccac gcaaatgtct tgattgtttg cgataacgct 721 gccgctggat taaagtcaaa gttgtag