Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Nag1p (NAG1), partial mRNA.


LOCUS       XM_707338                747 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_707338
VERSION     XM_707338.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 747)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 747)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 747)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 747)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 747)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 747)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_707338.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..747
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>747
                     /gene="NAG1"
                     /locus_tag="CAALFM_C604590CA"
                     /db_xref="GeneID:3645966"
     CDS             1..747
                     /gene="NAG1"
                     /locus_tag="CAALFM_C604590CA"
                     /note="Glucosamine-6-phosphate deaminase; required for
                     normal hyphal growth and mouse virulence; converts
                     glucosamine 6-P to fructose 6-P; reversible reaction in
                     vitro; gene and protein is GlcNAc-induced; Spider biofilm
                     induced"
                     /codon_start=1
                     /transl_table=12
                     /product="Nag1p"
                     /protein_id="XP_712431.2"
                     /db_xref="CGD:CAL0000199480"
                     /db_xref="GeneID:3645966"
                     /translation="MRQAIFSNPNDAAEYLANYIIAKINSTPRTFVLGLPTGSSPEGI
                     YAKLIEANKQGRVSFKNVVTFNMDEYLGLAPSDLQSYHYFMYDKFFNHIDIPRENIHI
                     LNGLAANIDEECANYEKKIKQYGRIDLFLGGLGPEGHLAFNEAGSSRNSKTRKVELVE
                     STIKANCRFFGNDESKVPKYALSVGISTILDNSDEIAIIVLGKNKQFALDKTVNGKPN
                     DPKYPSSYLQDHANVLIVCDNAAAGLKSKL"
     misc_feature    31..732
                     /gene="NAG1"
                     /locus_tag="CAALFM_C604590CA"
                     /note="Glucosamine-6-phosphate (GlcN6P) deaminase
                     subfamily; GlcN6P deaminase catalyzes the reversible
                     conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and
                     ammonium. The reaction is an aldo-keto isomerization
                     coupled with an amination or deamination. It...; Region:
                     GlcN6P_deaminase; cd01399"
                     /db_xref="CDD:238693"
     misc_feature    order(109..120,199..204,397..402,415..417,421..423,
                     502..504,613..615)
                     /gene="NAG1"
                     /locus_tag="CAALFM_C604590CA"
                     /note="active site"
                     /db_xref="CDD:238693"
     misc_feature    order(436..438,442..447,469..471,637..654,658..660,
                     682..690)
                     /gene="NAG1"
                     /locus_tag="CAALFM_C604590CA"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238693"
     misc_feature    order(439..444,460..471)
                     /gene="NAG1"
                     /locus_tag="CAALFM_C604590CA"
                     /note="allosteric site [active]"
                     /db_xref="CDD:238693"
     misc_feature    order(475..477,484..516,526..534)
                     /gene="NAG1"
                     /locus_tag="CAALFM_C604590CA"
                     /note="active site lid [active]"
                     /db_xref="CDD:238693"
     misc_feature    order(490..492,607..609,619..621,715..717,724..732)
                     /gene="NAG1"
                     /locus_tag="CAALFM_C604590CA"
                     /note="hexamer (dimer of trimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238693"
ORIGIN      
        1 atgagacaag ctatattttc caaccctaac gatgctgctg agtatttggc aaactatatc
       61 attgccaaaa tcaattccac tcccagaaca tttgttcttg gccttccaac cggatcatcc
      121 cctgaaggca tttatgccaa attgatcgaa gccaacaagc aaggccgtgt tagtttcaag
      181 aacgtcgtga ccttcaacat ggacgagtat ttgggattgg ccccatctga cttgcagtcg
      241 taccattatt tcatgtacga caagtttttc aaccatatcg atatcccgcg tgaaaatatc
      301 cacatcttga acggattggc cgcaaacatc gacgaggagt gtgccaacta cgaaaagaaa
      361 atcaaacaat acggaagaat cgatttgttc ttaggtgggt tgggcccaga aggtcatttg
      421 gcattcaacg aagcgggatc atcaagaaac tctaaaacaa gaaaggtcga gttggtcgaa
      481 agtaccatca aggcaaactg caggtttttc gggaacgacg agagcaaggt ccctaaatat
      541 gcattgagtg ttggcatttc caccatattg gacaactcag acgaaattgc cattatcgtg
      601 ttgggcaaaa ataaacaatt tgcattggac aaaactgtaa acgggaaacc aaacgaccca
      661 aaatacccat caagctattt acaagaccac gcaaatgtct tgattgtttg cgataacgct
      721 gccgctggat taaagtcaaa gttgtag