Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 putative serine--tRNA ligase


LOCUS       XM_707225               1491 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C600390WA), partial mRNA.
ACCESSION   XM_707225
VERSION     XM_707225.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1491)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1491)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1491)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1491)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1491)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1491)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1491
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1491
                     /locus_tag="CAALFM_C600390WA"
                     /db_xref="GeneID:3646086"
     CDS             1..1491
                     /locus_tag="CAALFM_C600390WA"
                     /note="Ortholog(s) have serine-tRNA ligase activity, role
                     in invasive growth in response to glucose limitation,
                     mitochondrial seryl-tRNA aminoacylation, pseudohyphal
                     growth and mitochondrion localization"
                     /codon_start=1
                     /transl_table=12
                     /product="putative serine--tRNA ligase"
                     /protein_id="XP_712318.1"
                     /db_xref="CGD:CAL0000178091"
                     /db_xref="GeneID:3646086"
                     /translation="MLCTGNRIILVQFSTVSARKKMTYTLHYSTNRSNIKARLSSMLN
                     TIRRYISTGKNSSTLLRAQIDINDILSRPKEYESSIHRRQLPQELIENINFITSNRPL
                     QAQLFSQINDMKKERTILAERLKSNVGDLQQFKERLKQLKSELKPLEKQVKTIQEKIY
                     AKAESLPNLIDVTVPTDPLKEEVVQFINCQSEEDAKVSNSSAVHDHKEIGVNFNILDF
                     SVASRVSGPSWYYLIGDGALLEQALIQYALSKARRRGYLMLTPPSIVKSEIVGACGFK
                     PNDQNNEKQIYELKGEHKSLTGTAEIPLAAFHSSTVFPSGTQFPIKYVGVSRAYRAEA
                     GASGKDTKGLYRVHEFTKVELFHFTTEEKAAQELEDLKDMQVEIVTELGLSAKLLNMP
                     SSDLGAPAMKKYDIEAWMPGRGSWGELTSCSNCGDYQSRRLGIRYNDDQEGRLKHVST
                     LNGTCMAVPRVIVALIEQNFNAEKNEISIPEVLQPFMDGKDKIVPN"
     misc_feature    190..507
                     /locus_tag="CAALFM_C600390WA"
                     /note="Seryl-tRNA synthetase N-terminal domain; Region:
                     Seryl_tRNA_N; pfam02403"
                     /db_xref="CDD:426757"
     misc_feature    613..1461
                     /locus_tag="CAALFM_C600390WA"
                     /note="Class II tRNA amino-acyl synthetase-like catalytic
                     core domain. Class II amino acyl-tRNA synthetases (aaRS)
                     share a common fold and generally attach an amino acid to
                     the 3' OH of ribose of the appropriate tRNA. PheRS is an
                     exception in that it attaches...; Region:
                     class_II_aaRS-like_core; cl00268"
                     /db_xref="CDD:444800"
     misc_feature    766..780
                     /locus_tag="CAALFM_C600390WA"
                     /note="motif 1; other site"
                     /db_xref="CDD:238391"
     misc_feature    order(769..774,778..780,916..921,988..990,994..996,
                     1126..1128)
                     /locus_tag="CAALFM_C600390WA"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238391"
     misc_feature    order(895..897,901..903,991..993,1048..1050,1054..1056,
                     1060..1068,1252..1257,1267..1269,1354..1359,1366..1371,
                     1378..1380)
                     /locus_tag="CAALFM_C600390WA"
                     /note="active site"
                     /db_xref="CDD:238391"
     misc_feature    988..996
                     /locus_tag="CAALFM_C600390WA"
                     /note="motif 2; other site"
                     /db_xref="CDD:238391"
     misc_feature    order(1369..1371,1378..1380)
                     /locus_tag="CAALFM_C600390WA"
                     /note="motif 3; other site"
                     /db_xref="CDD:238391"
ORIGIN      
        1 atgttgtgta caggaaacag aataattctt gttcaattct ctactgtgag tgcacgaaag
       61 aaaatgacct acaccttaca ttattctacc aatcgaagta acatcaaggc taggttatca
      121 agcatgctta acactatacg tagatacatt agcactggca aaaactcatc aacgttatta
      181 agagcacaaa tcgacattaa tgatattttg agtcgtccaa aagagtatga atcttcaatt
      241 caccgaagac aactaccaca agagttgatt gaaaacatca atttcatcac atcaaatcga
      301 ccattacaag cacaattgtt ttctcaaatc aatgacatga aaaaagaaag aactatccta
      361 gcagagcgtt taaagtcaaa cgtgggtgat ctacaacaat tcaaagaaag attgaagcaa
      421 ctcaaatctg aactaaaacc gttggaaaaa caagtgaaaa ccatccaaga aaaaatatac
      481 gccaaagccg aatctttgcc caatcttata gacgtaacag tccctacgga tcctttgaaa
      541 gaagaagttg tccaatttat aaattgccag tctgaagaag atgctaaagt ttcaaattcg
      601 tcagcagttc atgatcacaa ggaaatagga gtcaacttta atattttgga tttcagtgtg
      661 gcatctagag tatctggacc gtcttggtac tatttaattg gagatggtgc tttgcttgaa
      721 caagcgttaa ttcaatatgc gctctcaaaa gctcgcaggc gtgggtattt gatgcttact
      781 ccaccttcga ttgttaagtc agaaattgtt ggagcctgtg gattcaaacc aaatgatcaa
      841 aataatgaaa agcaaatcta tgaacttaaa ggcgaacaca agtccttgac aggtacagca
      901 gagataccat tggctgcatt ccattcttct actgtattcc cgagtggcac tcaattcccc
      961 ataaaatatg ttggtgtatc aagagcatac cgcgctgaag caggggccag tggaaaagat
     1021 actaagggat tgtatagagt gcatgagttt actaaagtcg agttattcca ttttacaaca
     1081 gaagagaagg ccgcacaaga attagaagat ctaaaggata tgcaagtgga aattgtcacg
     1141 gaattgggtc tatccgctaa attgttaaat atgccatcat ccgatttagg tgcaccagca
     1201 atgaaaaaat atgacatcga agcgtggatg ccaggaagag gttcctgggg agagctcaca
     1261 agctgttcta attgtggcga ttaccaatct cgaagattag gtatacgtta taatgatgat
     1321 caagaaggtc gtctcaaaca cgtttcaaca cttaacggta catgtatggc cgtccctaga
     1381 gtaattgttg cattaattga acaaaacttt aatgcagaaa agaatgaaat ttcaatacca
     1441 gaagttttgc agccattcat ggatggcaaa gataaaatcg ttcctaatta a