Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 uncharacterized protein (CAALFM_C600190WA),


LOCUS       XM_707202               1230 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_707202
VERSION     XM_707202.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1230)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1230)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1230)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1230)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1230)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1230)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_707202.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1230
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1230
                     /locus_tag="CAALFM_C600190WA"
                     /db_xref="GeneID:3646080"
     CDS             1..1230
                     /locus_tag="CAALFM_C600190WA"
                     /note="Ortholog of S. cerevisiae Rtt106; histone chaperone
                     that regulates chromatin structure in transcribed and
                     silenced chromosomal regions; affects transcriptional
                     elongation; Hap43-repressed; Spider biofilm repressed"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_712295.2"
                     /db_xref="CGD:CAL0000189137"
                     /db_xref="GeneID:3646080"
                     /translation="MDSAWVQQLPPELQNDIKAVVEKDQSSFAAFDNLHAFLTGGTTK
                     KRKLNAEPEEIPPETIIFEINEISFYSPVRKRMNLTLHLVEEDGNPSPALSIVNPSNN
                     IPELTFTGLDQAVKLCLLLPILGNTTNTQKKAICYLCFWMHDENMSKDPIVCQMNLDL
                     VKKSMIKNGKLPADIESKFITPRDALPLNPIQERIIDYFKRQFQLCGISMMNYMPCVS
                     IFRNTFSLNDDNAIAMNTDGASQPALVMVNCHKGAKEGVLILLQANKTNPAHIIFGFK
                     KPILVFEASQVLHTSYSNITRQTFSLNVVVLNKKQEQRELEFGMIDEKFYKVIDDFIK
                     LQGINDATFNQEESGDDSIEIVHVNNNDDDDDEEDDDFQSEDSGSDVEEEYNSDLNEP
                     LAAHEEDGVFERGIEIE"
     misc_feature    7..153
                     /locus_tag="CAALFM_C600190WA"
                     /note="histone chaperone RTT106, regulator of Ty1
                     transposition protein 106; N-terminal homodimerization
                     domain; Region: RTT106_N; cl16939"
                     /db_xref="CDD:450127"
     misc_feature    order(13..15,25..30,37..39,46..51,58..63,67..72,79..84,
                     88..93,100..105,109..117,124..126)
                     /locus_tag="CAALFM_C600190WA"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:211429"
     misc_feature    160..639
                     /locus_tag="CAALFM_C600190WA"
                     /note="Pleckstrin homology domain; Region: PH_18;
                     pfam18469"
                     /db_xref="CDD:436524"
     misc_feature    721..1005
                     /locus_tag="CAALFM_C600190WA"
                     /note="Pleckstrin homology-like domain, repeat 2, of
                     Histone chaperone RTT106 (regulator of Ty1 transposition
                     protein 106); Region: PH2-like_Rtt106; cd13304"
                     /db_xref="CDD:241458"
     misc_feature    order(751..753,760..762,826..831)
                     /locus_tag="CAALFM_C600190WA"
                     /note="dsDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:241458"
     misc_feature    order(763..765,961..963)
                     /locus_tag="CAALFM_C600190WA"
                     /note="negative patch; other site"
                     /db_xref="CDD:241458"
     misc_feature    order(784..789,853..855,994..996,1003..1005)
                     /locus_tag="CAALFM_C600190WA"
                     /note="K56ac binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:241458"
     misc_feature    874..903
                     /locus_tag="CAALFM_C600190WA"
                     /note="H3-H4 binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:241458"
     misc_feature    order(886..888,895..897)
                     /locus_tag="CAALFM_C600190WA"
                     /note="H3 histone binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:241458"
ORIGIN      
        1 atggattcag catgggttca acaattaccc cctgaactac agaatgacat caaagctgtt
       61 gttgaaaaag accagtcgag ttttgctgcg ttcgataact tacatgcatt cttaacaggc
      121 ggcacaacca aaaaacgaaa attgaacgct gaaccagaag aaatccctcc agaaacgata
      181 atttttgaaa tcaatgagat ttcgttttat tcaccagttc ggaaaagaat gaacttgacc
      241 cttcatttgg ttgaagagga cggcaacccc agcccggctc tttccatcgt caacccttcc
      301 aacaatatcc cagaattgac attcacagga ctagatcaag cagtaaaact ttgtttgttg
      361 ttgccaatac taggaaacac caccaacaca caaaagaaag caatttgcta cttatgtttc
      421 tggatgcacg acgaaaacat gtcgaaagac ccaattgttt gtcaaatgaa cttggacttg
      481 gtgaaaaagc tgatgatcaa gaatgggaaa ttgcctgctg atatcgaatc gaaattcatc
      541 acaccaagag atgcacttcc attgaaccca atccaagaac gcataatcga ctactttaaa
      601 agacaattcc agctttgtgg tataagcatg atgaactata tgccgtgtgt atcgatcttt
      661 agaaacacgt ttagtttgaa tgacgacaat gccattgcca tgaataccga cggtgcgtcc
      721 cagcctgcac tagttatggt aaactgccac aagggtgcca aagaaggggt attgatcctt
      781 ttacaagcca ataaaactaa ccctgcccac atcatatttg ggtttaaaaa gccaattcta
      841 gttttcgaag caagtcaagt gttgcacacc agctatagca acatcacgcg ccaaacattt
      901 agcttgaatg tggtggttct aaacaaaaaa caagaacaaa gagagttgga gtttggcatg
      961 attgatgaaa agttctacaa agttattgac gattttataa aattacaagg tatcaacgat
     1021 gctacattca accaagaaga aagtggtgac gacctgatag agatcgttca tgtcaacaat
     1081 aacgacgacg acgatgacga ggaagatgat gatttccaat ctgaggatag tggcagtgac
     1141 gttgaagaag agtataatag tgatttgaac gagccgctag ctgcacacga agaggatggg
     1201 gtgtttgaaa gaggtattga aatcgaataa