Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707202 1230 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_707202 VERSION XM_707202.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1230) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1230) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1230) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1230) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1230) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1230) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_707202.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1230 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1230 /locus_tag="CAALFM_C600190WA" /db_xref="GeneID:3646080" CDS 1..1230 /locus_tag="CAALFM_C600190WA" /note="Ortholog of S. cerevisiae Rtt106; histone chaperone that regulates chromatin structure in transcribed and silenced chromosomal regions; affects transcriptional elongation; Hap43-repressed; Spider biofilm repressed" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_712295.2" /db_xref="CGD:CAL0000189137" /db_xref="GeneID:3646080" /translation="MDSAWVQQLPPELQNDIKAVVEKDQSSFAAFDNLHAFLTGGTTK KRKLNAEPEEIPPETIIFEINEISFYSPVRKRMNLTLHLVEEDGNPSPALSIVNPSNN IPELTFTGLDQAVKLCLLLPILGNTTNTQKKAICYLCFWMHDENMSKDPIVCQMNLDL VKKSMIKNGKLPADIESKFITPRDALPLNPIQERIIDYFKRQFQLCGISMMNYMPCVS IFRNTFSLNDDNAIAMNTDGASQPALVMVNCHKGAKEGVLILLQANKTNPAHIIFGFK KPILVFEASQVLHTSYSNITRQTFSLNVVVLNKKQEQRELEFGMIDEKFYKVIDDFIK LQGINDATFNQEESGDDSIEIVHVNNNDDDDDEEDDDFQSEDSGSDVEEEYNSDLNEP LAAHEEDGVFERGIEIE" misc_feature 7..153 /locus_tag="CAALFM_C600190WA" /note="histone chaperone RTT106, regulator of Ty1 transposition protein 106; N-terminal homodimerization domain; Region: RTT106_N; cl16939" /db_xref="CDD:450127" misc_feature order(13..15,25..30,37..39,46..51,58..63,67..72,79..84, 88..93,100..105,109..117,124..126) /locus_tag="CAALFM_C600190WA" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:211429" misc_feature 160..639 /locus_tag="CAALFM_C600190WA" /note="Pleckstrin homology domain; Region: PH_18; pfam18469" /db_xref="CDD:436524" misc_feature 721..1005 /locus_tag="CAALFM_C600190WA" /note="Pleckstrin homology-like domain, repeat 2, of Histone chaperone RTT106 (regulator of Ty1 transposition protein 106); Region: PH2-like_Rtt106; cd13304" /db_xref="CDD:241458" misc_feature order(751..753,760..762,826..831) /locus_tag="CAALFM_C600190WA" /note="dsDNA binding site [nucleotide binding]; other site" /db_xref="CDD:241458" misc_feature order(763..765,961..963) /locus_tag="CAALFM_C600190WA" /note="negative patch; other site" /db_xref="CDD:241458" misc_feature order(784..789,853..855,994..996,1003..1005) /locus_tag="CAALFM_C600190WA" /note="K56ac binding site [polypeptide binding]; other site" /db_xref="CDD:241458" misc_feature 874..903 /locus_tag="CAALFM_C600190WA" /note="H3-H4 binding site [polypeptide binding]; other site" /db_xref="CDD:241458" misc_feature order(886..888,895..897) /locus_tag="CAALFM_C600190WA" /note="H3 histone binding site [polypeptide binding]; other site" /db_xref="CDD:241458" ORIGIN 1 atggattcag catgggttca acaattaccc cctgaactac agaatgacat caaagctgtt 61 gttgaaaaag accagtcgag ttttgctgcg ttcgataact tacatgcatt cttaacaggc 121 ggcacaacca aaaaacgaaa attgaacgct gaaccagaag aaatccctcc agaaacgata 181 atttttgaaa tcaatgagat ttcgttttat tcaccagttc ggaaaagaat gaacttgacc 241 cttcatttgg ttgaagagga cggcaacccc agcccggctc tttccatcgt caacccttcc 301 aacaatatcc cagaattgac attcacagga ctagatcaag cagtaaaact ttgtttgttg 361 ttgccaatac taggaaacac caccaacaca caaaagaaag caatttgcta cttatgtttc 421 tggatgcacg acgaaaacat gtcgaaagac ccaattgttt gtcaaatgaa cttggacttg 481 gtgaaaaagc tgatgatcaa gaatgggaaa ttgcctgctg atatcgaatc gaaattcatc 541 acaccaagag atgcacttcc attgaaccca atccaagaac gcataatcga ctactttaaa 601 agacaattcc agctttgtgg tataagcatg atgaactata tgccgtgtgt atcgatcttt 661 agaaacacgt ttagtttgaa tgacgacaat gccattgcca tgaataccga cggtgcgtcc 721 cagcctgcac tagttatggt aaactgccac aagggtgcca aagaaggggt attgatcctt 781 ttacaagcca ataaaactaa ccctgcccac atcatatttg ggtttaaaaa gccaattcta 841 gttttcgaag caagtcaagt gttgcacacc agctatagca acatcacgcg ccaaacattt 901 agcttgaatg tggtggttct aaacaaaaaa caagaacaaa gagagttgga gtttggcatg 961 attgatgaaa agttctacaa agttattgac gattttataa aattacaagg tatcaacgat 1021 gctacattca accaagaaga aagtggtgac gacctgatag agatcgttca tgtcaacaat 1081 aacgacgacg acgatgacga ggaagatgat gatttccaat ctgaggatag tggcagtgac 1141 gttgaagaag agtataatag tgatttgaac gagccgctag ctgcacacga agaggatggg 1201 gtgtttgaaa gaggtattga aatcgaataa