Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_707014 1152 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_707014 VERSION XM_707014.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1152) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1152) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1152) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1152) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1152) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1152) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_707014.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1152 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1152 /gene="GLE2" /locus_tag="CAALFM_C604360CA" /db_xref="GeneID:3646293" CDS 1..1152 /gene="GLE2" /locus_tag="CAALFM_C604360CA" /note="Putative nuclear pore complex; possibly an essential gene, disruptants not obtained by UAU1 method; rat catheter biofilm repressed" /codon_start=1 /transl_table=12 /product="RNA export factor" /protein_id="XP_712107.2" /db_xref="CGD:CAL0000190268" /db_xref="GeneID:3646293" /translation="MSFLGSSSTGTSTTATSSAVTGQELLNDITINNPPEDSIEDISF SPQQDLLAVASWDKKVRIYEIDPNSGNNMGRAMYEHEAPVFSSRWSIDGTKIISGGAD NQVKIFDLATQQAQQIGQHDSAVKSVRYVECGPTNTQVVASGSWDKTLKYWDMRSPQP VSTINLPERVYSMDNSQKLLVVGCADRHISIIDLNNPQQIFKSSQSPLKWQTRCVSCY PQANGFAVGSIEGRCAIQYITENEQKKFGFSFKCHRKSGGNTTGTTNTTGGAGAGLRT TSSSNANESHAYSVNAISFHPIYGTFSTAGSDGTFCFWDKDAKQRLKSFPELPGAISA TAFNKTGTIFAYAISYDWSLGYMGNRQDYPNIIKLHATKDLEIKQKNKR" misc_feature 106..1035 /gene="GLE2" /locus_tag="CAALFM_C604360CA" /note="WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from...; Region: WD40; cl29593" /db_xref="CDD:475233" misc_feature 121..237 /gene="GLE2" /locus_tag="CAALFM_C604360CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature order(157..159,169..171,187..192,235..240,292..294, 304..306,322..327,358..363,424..426,439..441,457..462, 499..501,541..543,556..558,574..579,607..612,676..678, 688..690,814..819,853..858,907..909,922..924,940..945, 979..984) /gene="GLE2" /locus_tag="CAALFM_C604360CA" /note="structural tetrad [active]" /db_xref="CDD:238121" misc_feature 253..360 /gene="GLE2" /locus_tag="CAALFM_C604360CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 373..495 /gene="GLE2" /locus_tag="CAALFM_C604360CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 511..615 /gene="GLE2" /locus_tag="CAALFM_C604360CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 634..753 /gene="GLE2" /locus_tag="CAALFM_C604360CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 868..948 /gene="GLE2" /locus_tag="CAALFM_C604360CA" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" ORIGIN 1 atgtcattct tgggtagttc gtcaacagga acatcgacca cagccacatc aagtgctgtt 61 actggtcaag aattattaaa tgatataacc ataaataacc caccggaaga ttcaattgaa 121 gatatttcat tctcaccaca acaagatttg ttagctgtag caagttggga taaaaaagtt 181 cgaatttatg aaattgatcc taattcagga aataatatgg gtcgagcaat gtatgaacat 241 gaagctccag ttttcagttc tcgatggtct attgatggga cgaaaattat atcaggtggt 301 gccgacaatc aagtgaaaat atttgatttg gcaacccagc aagcccaaca aattggacaa 361 catgattctg ccgttaaatc agttagatac gttgaatgtg gtccaacaaa tactcaagtt 421 gttgctagtg gatcatggga taaaacatta aaatactggg atatgagatc acctcaacct 481 gtttcaacaa tcaatttacc agaaagagtt tattcgatgg ataattctca gaaattatta 541 gttgttggat gtgctgatag acatattagt ataattgatt tgaataaccc tcaacaaatt 601 ttcaaaagtt cacaatcacc cttgaaatgg caaactcgtt gtgtttcatg ttatcctcaa 661 gcaaatggat ttgctgttgg atctattgaa ggaagatgtg ccatacaata cattacagaa 721 aatgaacaga aaaaatttgg attttcattt aaatgtcata gaaaatccgg tggtaatact 781 actggtacca ctaatactac tggtggtgca ggtgcaggct taagaaccac aagtagttct 841 aatgccaatg aatctcatgc atattcagtc aatgccatct cattccatcc tatatatggt 901 acattcagta ctgctggatc agatggtaca ttttgctttt gggataaaga tgctaagcaa 961 cgattaaaat cgtttcctga attgccaggg gcaatatctg ccactgcatt taataaaact 1021 ggtactatat ttgcctatgc gattagttat gattggtcat tgggatatat gggtaataga 1081 caagattatc caaatatcat caaactacat gcaaccaaag atttagaaat aaaacaaaag 1141 aataaaaggt ga