Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 RNA export factor (GLE2), partial mRNA.


LOCUS       XM_707014               1152 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_707014
VERSION     XM_707014.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1152)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1152)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1152)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1152)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1152)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1152)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_707014.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1152
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1152
                     /gene="GLE2"
                     /locus_tag="CAALFM_C604360CA"
                     /db_xref="GeneID:3646293"
     CDS             1..1152
                     /gene="GLE2"
                     /locus_tag="CAALFM_C604360CA"
                     /note="Putative nuclear pore complex; possibly an
                     essential gene, disruptants not obtained by UAU1 method;
                     rat catheter biofilm repressed"
                     /codon_start=1
                     /transl_table=12
                     /product="RNA export factor"
                     /protein_id="XP_712107.2"
                     /db_xref="CGD:CAL0000190268"
                     /db_xref="GeneID:3646293"
                     /translation="MSFLGSSSTGTSTTATSSAVTGQELLNDITINNPPEDSIEDISF
                     SPQQDLLAVASWDKKVRIYEIDPNSGNNMGRAMYEHEAPVFSSRWSIDGTKIISGGAD
                     NQVKIFDLATQQAQQIGQHDSAVKSVRYVECGPTNTQVVASGSWDKTLKYWDMRSPQP
                     VSTINLPERVYSMDNSQKLLVVGCADRHISIIDLNNPQQIFKSSQSPLKWQTRCVSCY
                     PQANGFAVGSIEGRCAIQYITENEQKKFGFSFKCHRKSGGNTTGTTNTTGGAGAGLRT
                     TSSSNANESHAYSVNAISFHPIYGTFSTAGSDGTFCFWDKDAKQRLKSFPELPGAISA
                     TAFNKTGTIFAYAISYDWSLGYMGNRQDYPNIIKLHATKDLEIKQKNKR"
     misc_feature    106..1035
                     /gene="GLE2"
                     /locus_tag="CAALFM_C604360CA"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cl29593"
                     /db_xref="CDD:475233"
     misc_feature    121..237
                     /gene="GLE2"
                     /locus_tag="CAALFM_C604360CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    order(157..159,169..171,187..192,235..240,292..294,
                     304..306,322..327,358..363,424..426,439..441,457..462,
                     499..501,541..543,556..558,574..579,607..612,676..678,
                     688..690,814..819,853..858,907..909,922..924,940..945,
                     979..984)
                     /gene="GLE2"
                     /locus_tag="CAALFM_C604360CA"
                     /note="structural tetrad [active]"
                     /db_xref="CDD:238121"
     misc_feature    253..360
                     /gene="GLE2"
                     /locus_tag="CAALFM_C604360CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    373..495
                     /gene="GLE2"
                     /locus_tag="CAALFM_C604360CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    511..615
                     /gene="GLE2"
                     /locus_tag="CAALFM_C604360CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    634..753
                     /gene="GLE2"
                     /locus_tag="CAALFM_C604360CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    868..948
                     /gene="GLE2"
                     /locus_tag="CAALFM_C604360CA"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
ORIGIN      
        1 atgtcattct tgggtagttc gtcaacagga acatcgacca cagccacatc aagtgctgtt
       61 actggtcaag aattattaaa tgatataacc ataaataacc caccggaaga ttcaattgaa
      121 gatatttcat tctcaccaca acaagatttg ttagctgtag caagttggga taaaaaagtt
      181 cgaatttatg aaattgatcc taattcagga aataatatgg gtcgagcaat gtatgaacat
      241 gaagctccag ttttcagttc tcgatggtct attgatggga cgaaaattat atcaggtggt
      301 gccgacaatc aagtgaaaat atttgatttg gcaacccagc aagcccaaca aattggacaa
      361 catgattctg ccgttaaatc agttagatac gttgaatgtg gtccaacaaa tactcaagtt
      421 gttgctagtg gatcatggga taaaacatta aaatactggg atatgagatc acctcaacct
      481 gtttcaacaa tcaatttacc agaaagagtt tattcgatgg ataattctca gaaattatta
      541 gttgttggat gtgctgatag acatattagt ataattgatt tgaataaccc tcaacaaatt
      601 ttcaaaagtt cacaatcacc cttgaaatgg caaactcgtt gtgtttcatg ttatcctcaa
      661 gcaaatggat ttgctgttgg atctattgaa ggaagatgtg ccatacaata cattacagaa
      721 aatgaacaga aaaaatttgg attttcattt aaatgtcata gaaaatccgg tggtaatact
      781 actggtacca ctaatactac tggtggtgca ggtgcaggct taagaaccac aagtagttct
      841 aatgccaatg aatctcatgc atattcagtc aatgccatct cattccatcc tatatatggt
      901 acattcagta ctgctggatc agatggtaca ttttgctttt gggataaaga tgctaagcaa
      961 cgattaaaat cgtttcctga attgccaggg gcaatatctg ccactgcatt taataaaact
     1021 ggtactatat ttgcctatgc gattagttat gattggtcat tgggatatat gggtaataga
     1081 caagattatc caaatatcat caaactacat gcaaccaaag atttagaaat aaaacaaaag
     1141 aataaaaggt ga