Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_705753 906 bp mRNA linear PLN 18-APR-2022 mRNA. ACCESSION XM_705753 VERSION XM_705753.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 906) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 906) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 906) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 906) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 906) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 906) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..906 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>906 /gene="MCR1" /locus_tag="CAALFM_C602040WA" /db_xref="GeneID:3647561" CDS 1..906 /gene="MCR1" /locus_tag="CAALFM_C602040WA" /note="NADH-cytochrome-b5 reductase; soluble in hyphae; alkaline downregulated; farnesol, ketoconazole or flucytosine induced; protein present in exponential and stationary growth phase yeast; YNB biofilm induced; rat catheter biofilm repressed" /codon_start=1 /transl_table=12 /product="cytochrome-b5 reductase" /protein_id="XP_710845.1" /db_xref="CGD:CAL0000182452" /db_xref="GeneID:3647561" /translation="MLTHHLSKLATPKFLVPFAGATALSIGLALQYSTSNNYIANETG KTFTDSNEWVDLKLSKSIDLTHNTKHLVFKLKDENDVSGLITASCLLTKFVTPKGNNV IRPYTPVSDVNQSGEIDFVIKKYDGGKMSSHIFDLKEGETLSFKGPIVKWKWEPNQFK SIALIGGGTGITPLYQLLHQITSNPKDNTKVNLIYGNLTPEDILLKKEIDAIASKHKD QVKVHYFVDKADEKKWEGQIGFITKEFLQKELEKPGSDFKVFVCGPPGLYKAISGPKV SPTDQGELTGALKDLGFEKEHVFKF" misc_feature 166..903 /gene="MCR1" /locus_tag="CAALFM_C602040WA" /note="Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor. Like ferredoxin reductases, these proteins have an N-terminal FAD binding subdomain and a C-terminal NADH binding subdomain, separated by a...; Region: cyt_b5_reduct_like; cd06183" /db_xref="CDD:99780" misc_feature order(265..267,310..321,361..369,373..375,379..393, 505..507,514..519,901..903) /gene="MCR1" /locus_tag="CAALFM_C602040WA" /note="FAD binding pocket [chemical binding]; other site" /db_xref="CDD:99780" misc_feature order(310..312,316..321) /gene="MCR1" /locus_tag="CAALFM_C602040WA" /note="FAD binding motif [chemical binding]; other site" /db_xref="CDD:99780" misc_feature order(367..369,373..375,505..510,586..594,679..681, 718..720,787..801) /gene="MCR1" /locus_tag="CAALFM_C602040WA" /note="NAD binding pocket [chemical binding]; other site" /db_xref="CDD:99780" misc_feature order(382..384,391..393,400..402,418..420,442..444, 448..450) /gene="MCR1" /locus_tag="CAALFM_C602040WA" /note="phosphate binding motif [ion binding]; other site" /db_xref="CDD:99780" misc_feature order(490..492,502..513,517..519) /gene="MCR1" /locus_tag="CAALFM_C602040WA" /note="beta-alpha-beta structure motif; other site" /db_xref="CDD:99780" ORIGIN 1 atgttgactc atcatttatc gaaattggct actccaaaat tcttagtacc attcgctggt 61 gccactgctt tgtcaattgg tttggcattg caatattcta cttccaacaa ttacattgct 121 aacgaaactg gtaaaacttt cactgatagc aatgaatggg tggacttgaa attatctaag 181 tcaattgatt tgactcataa caccaaacac ttggttttca agttaaaaga tgagaatgat 241 gtttctggtt tgatcactgc ttcatgtttg ttgaccaaat ttgttacacc aaagggtaac 301 aatgttattc gtccatatac ccctgtctct gatgttaacc aatctggtga aattgatttc 361 gtgattaaaa aatacgacgg aggtaaaatg tcaagtcaca ttttcgattt gaaagaaggt 421 gaaaccttat cattcaaagg accaattgtt aaatggaaat gggaaccaaa tcaattcaag 481 tccattgctt tgattggtgg tggtactggt attactccat tataccaatt gttgcatcaa 541 atcacttcta atccaaagga caacaccaaa gttaatttga tttacggtaa cttgactcca 601 gaagatatct tgttaaagaa agaaatcgat gctattgctt ctaaacacaa ggaccaagtt 661 aaagttcatt actttgttga caaggcagat gaaaagaaat gggaaggtca aattggtttc 721 attactaaag aattcttaca aaaagaatta gaaaaaccag gttctgattt caaggttttt 781 gtttgtggtc caccaggttt atacaaggct atatcaggtc ctaaagtttc cccaactgat 841 caaggtgaat tgactggtgc tttgaaagat ttgggtttcg aaaaagaaca tgtctttaaa 901 ttttag