Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 cytochrome-b5 reductase (MCR1), partial


LOCUS       XM_705753                906 bp    mRNA    linear   PLN 18-APR-2022
            mRNA.
ACCESSION   XM_705753
VERSION     XM_705753.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 906)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 906)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 906)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 906)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 906)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 906)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..906
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>906
                     /gene="MCR1"
                     /locus_tag="CAALFM_C602040WA"
                     /db_xref="GeneID:3647561"
     CDS             1..906
                     /gene="MCR1"
                     /locus_tag="CAALFM_C602040WA"
                     /note="NADH-cytochrome-b5 reductase; soluble in hyphae;
                     alkaline downregulated; farnesol, ketoconazole or
                     flucytosine induced; protein present in exponential and
                     stationary growth phase yeast; YNB biofilm induced; rat
                     catheter biofilm repressed"
                     /codon_start=1
                     /transl_table=12
                     /product="cytochrome-b5 reductase"
                     /protein_id="XP_710845.1"
                     /db_xref="CGD:CAL0000182452"
                     /db_xref="GeneID:3647561"
                     /translation="MLTHHLSKLATPKFLVPFAGATALSIGLALQYSTSNNYIANETG
                     KTFTDSNEWVDLKLSKSIDLTHNTKHLVFKLKDENDVSGLITASCLLTKFVTPKGNNV
                     IRPYTPVSDVNQSGEIDFVIKKYDGGKMSSHIFDLKEGETLSFKGPIVKWKWEPNQFK
                     SIALIGGGTGITPLYQLLHQITSNPKDNTKVNLIYGNLTPEDILLKKEIDAIASKHKD
                     QVKVHYFVDKADEKKWEGQIGFITKEFLQKELEKPGSDFKVFVCGPPGLYKAISGPKV
                     SPTDQGELTGALKDLGFEKEHVFKF"
     misc_feature    166..903
                     /gene="MCR1"
                     /locus_tag="CAALFM_C602040WA"
                     /note="Cytochrome b5 reductase catalyzes the reduction of
                     2 molecules of cytochrome b5 using NADH as an electron
                     donor. Like ferredoxin reductases, these proteins have an
                     N-terminal FAD binding subdomain and a C-terminal NADH
                     binding subdomain, separated by a...; Region:
                     cyt_b5_reduct_like; cd06183"
                     /db_xref="CDD:99780"
     misc_feature    order(265..267,310..321,361..369,373..375,379..393,
                     505..507,514..519,901..903)
                     /gene="MCR1"
                     /locus_tag="CAALFM_C602040WA"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99780"
     misc_feature    order(310..312,316..321)
                     /gene="MCR1"
                     /locus_tag="CAALFM_C602040WA"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99780"
     misc_feature    order(367..369,373..375,505..510,586..594,679..681,
                     718..720,787..801)
                     /gene="MCR1"
                     /locus_tag="CAALFM_C602040WA"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99780"
     misc_feature    order(382..384,391..393,400..402,418..420,442..444,
                     448..450)
                     /gene="MCR1"
                     /locus_tag="CAALFM_C602040WA"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99780"
     misc_feature    order(490..492,502..513,517..519)
                     /gene="MCR1"
                     /locus_tag="CAALFM_C602040WA"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99780"
ORIGIN      
        1 atgttgactc atcatttatc gaaattggct actccaaaat tcttagtacc attcgctggt
       61 gccactgctt tgtcaattgg tttggcattg caatattcta cttccaacaa ttacattgct
      121 aacgaaactg gtaaaacttt cactgatagc aatgaatggg tggacttgaa attatctaag
      181 tcaattgatt tgactcataa caccaaacac ttggttttca agttaaaaga tgagaatgat
      241 gtttctggtt tgatcactgc ttcatgtttg ttgaccaaat ttgttacacc aaagggtaac
      301 aatgttattc gtccatatac ccctgtctct gatgttaacc aatctggtga aattgatttc
      361 gtgattaaaa aatacgacgg aggtaaaatg tcaagtcaca ttttcgattt gaaagaaggt
      421 gaaaccttat cattcaaagg accaattgtt aaatggaaat gggaaccaaa tcaattcaag
      481 tccattgctt tgattggtgg tggtactggt attactccat tataccaatt gttgcatcaa
      541 atcacttcta atccaaagga caacaccaaa gttaatttga tttacggtaa cttgactcca
      601 gaagatatct tgttaaagaa agaaatcgat gctattgctt ctaaacacaa ggaccaagtt
      661 aaagttcatt actttgttga caaggcagat gaaaagaaat gggaaggtca aattggtttc
      721 attactaaag aattcttaca aaaagaatta gaaaaaccag gttctgattt caaggttttt
      781 gtttgtggtc caccaggttt atacaaggct atatcaggtc ctaaagtttc cccaactgat
      841 caaggtgaat tgactggtgc tttgaaagat ttgggtttcg aaaaagaaca tgtctttaaa
      901 ttttag