Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_070218447           14426 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X38, mRNA.
ACCESSION   XM_070218447
VERSION     XM_070218447.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..14426
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..14426
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 9
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             209..13753
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X37"
                     /protein_id="XP_070074548.1"
                     /db_xref="GeneID:108055788"
                     /translation="MGSPGSQAPAIAIGISNGRRGHTGSLLLRLLLVAFVLNACHVPP
                     TNAKQITKSKVDDQDFILADTQSLQGSVDLDDDEAFLIPPDSEEKLDKKFTPEGNWWS
                     QGLHRVRRSLNSFFGSDDDDQEKERERQRQRQNNRDAANRQKELRRQQKESQNREKQL
                     RLERQERQRLAKRNNHVVFNRVTDPRKRASDLYDENEASGLNEEETTTYRTYFVVNEP
                     YSDDYKERDSLQFQNLQKLLDEDLRNFFNRNFENNDDEEQEIHSTLERVDQTKDHFKI
                     RVQLRVDLPSSINDFGSKLEQQLNVYKRIDRLGASTDGVFTFTESSVYKYEHQYDIVT
                     PRVIVSGQPITEKPVEAPQEFDEDPIEVALPTDEVEGSGQDSGSCRGDATFQCRRSGK
                     TICDEMRCDGSRDCPDAEDEEGCEVCNELQFKCDNKCLPLNKRCDNRYDCEDQTDEAG
                     CQRYEVEESQPQPQPQPQPEPEPEPEPEPEPEPEPEPEPEEPITDNEQPEQNSECRAT
                     EFRCNNGDCIDIRKRCDHISDCSEGEDENEECPAACSGMEYQCRDGTRCISLSQQCDG
                     HSDCSDADDEEHCDGSGNDGEDCRFDEFRCGTGECIPMRQVCDNIYDCNDYSDEVSCA
                     EEEEDSVGIPIGRPPQRPAPKHDWLDELDANEYHVYHPSNVYELANSKNPCASNQFRC
                     ATTNVCIPLHLRCDNFYHCNDMSDEKDCEQYQRRTTTTTRRPSTSARPSFTFTFTTQG
                     PGLLERRNSTTSRTTAGSTTRATEAPQWPWATRPTETTTTNPITTVGVASSSPQSSCL
                     ENIEFACHNRDCIPIESVCDGTPDCGRSEDEDDALCKCTADKYKCQHGGGCIPKTQVC
                     DGKPQCRDRSDESACHLNGRLNKTRLGVQCQENQYQCGDGSCISGYKRCNGINDCADD
                     ADEYNCIYTYNEDYVDPDDNPLNECDILEFECDYSLCLPLEKKCDGYADCEDLSDEFE
                     CQSYTENCLLSEFECDGYCLPRDQLCNGIINCQDGSDERNCTFCREDAYLCTTGECVA
                     VNQRCNGIVECADGSDERHCARIYCPPNRLACNGRCVSRRIRCDGKRDCLDGYDEMYC
                     PETNYHYPTHNPKPKTCRTHEWQCTNLECIEMRLKCDDVPDCSDGSDEDLSICFGTAT
                     TRLKPSDCGPDQFFCDDLCYNRSIRCNGHMDCSDGSDEIACSSLSVLPCPQHQCPSGR
                     CYSESERCDRHRHCEDGSDEANCCYADQFRCNNGDCIAESAHCDGNIDCSDQSDELDC
                     GGDSQCLPNQFRCKNGQCVSSTARCNKRSDCLDGSDEQNCGHHHVEVSPGSTGSTSTT
                     TSTTAMTPLRIICPPTSFKCENGPCISLGLKCNGHVDCPYDSSDEADCGQISNDIDPN
                     EPNNSGRGTNQLKLKTYPDNQIIKESREVIFRCRDEGPNRAKVKWSRPGGRPLPPGFT
                     DRNGRLEIPNIRVEDAGAYVCEAVGYANYIPGQHVTVNLNVERLNEREIRPDSACTEY
                     QATCMNGECIDKSGICDGHPDCSDGSDEHSCSLGLKCQPNQFMCSNSKCVDRTWRCDG
                     ENDCGDNSDETSCDPEPSDAPCRYDEFQCRSGHCIPKSFQCDYMNDCTDGTDEIGCSV
                     PSPMTLPAPSIVVMEYEVLELTCVGTGVPTPTIVWRLNWGHVPEKCESKSYGGTGTLR
                     CPNMRPQDSGAYSCEFINTRGTFYPKTNSIVTVTPVRSDVCKAGFFNMLARKSEECVQ
                     CFCFGVSTNCDSANLFTYAIQPPILSHRVVSVELSPFRQIVINEASPGQDLLTLHHGV
                     QFRASNVHYNGRETPFLALPAEYMGNQLKSYGGNLRYEVRYNGNGRPVSGPDVIITGN
                     SFTLTHRVRTHPGQNNRVTIPFLPGGWTKPDGRKGTREDIMMILANVDNILIRLGYLD
                     STAREVDLINIALDSAGSADQGLGSASLVEKCTCPPGYVGDSCESCASGYVRQARGPW
                     LGHCVPFTPEPCPAGTYGNPRLGVPCQECPCPHAGANNFASGCQQSPDGDVICRCNEG
                     YAGKRCEHCAQGYQGNPLAPGGVCRKIPDSSCNVDGTYNIYSNGTCQCKDSVIGEQCD
                     TCAPKSFHLNSFTYTGCIECFCSGVGLDCDSSSWYRNQVTSTFGRTRVNHGFALISDY
                     MRNTPVTVPVSMSTQANALSFVGSAEQAGNTLYWSLPAAFLGNKLTSYGGKLSYTLSY
                     SPLPSGIMSRNSAPDVVIKSGEDLRLIHYRKSQVSPSVANTYAVEIKESAWQRGDELV
                     PNREHVLMALSNITAIYIKATYTTSTKEASLRSVTLDTATATNLGTARAVEVEQCRCP
                     EGYLGLSCEQCAPGYTRDPEAGIYLGLCRPCECNGHSKYCNSETGECESCSDNTEGFN
                     CDRCAAGYVGDATRGTSYDCQYDDGGYPTSRPPAPGNQTAECLVNCQQEGTAGCRGYQ
                     CECKRNVAGDRCDQCRPGTYGLSAQNPDGCKECYCSGLTNQCRSASLYRQLIPVDFIS
                     TPPLITDEFGDIMDRDNLVPDVPRNVYTYKHTSYTPKYWSLRGSVLGNQLLSYGGRLE
                     YSLIVESVGRDHRGKDVVLIGNGLKLIWSRPDGHDNEQEYHVRLHEDEQWTVEDRGSA
                     RQATRADFMTVLSDLQHILILATPKVPTVSTSISNVILESSITTRAPGATHASDIELC
                     QCPSGYTGTSCESCAPLHYRDASGRCSQCPCDASNTESCGLVSGGNVECQCRPRWRGD
                     RCREIETNEPTPEPDTSTDDPVRTQIIVSIARPEITILPVGGSLTLSCTGRMRWTNSP
                     VFVNWYKQGSHLPEGVEVQGGNLQLFNLQISDSGIYICQAVSNETGHSFTDHVSITVS
                     QEDQRSPAHIVDLPNDVTFEEYVSNEIVCEVEGNPPPTVTWTRVDGHADAQSTRTDNN
                     RLVFDSPRKSDEGRYRCQAENSLSREEKYVVVYVRSNPPQPPPQQDRLYITPQEVNGV
                     AGDSFQLSCQFTSAASLRYDWSHDGRSLSASSPRNVVVRGNVLEVRDANVRDSGTYTC
                     VAFDLRTRRNFTESARVYIEQPNEPGILGDKPHILTLEQNIIIVQGEDLSITCEASGT
                     PYPSIKWTKVQENLAENVRISGNVLTIYGGRSENRGLYSCIAENSHGSDQSSTSIDIE
                     PRERPSLTIDTATQKVSVGSQASLYCAAQGIPEPTVEWVRTDGQPLSPRHKVQAPGYV
                     VIDDIVLDDSGTYECRASNIAGQVSGLATINVQEPTLVRIEPDRQHHIVTQGDELSLS
                     CVGSGVPTPSVFWSFEGRDVDRMGVPEGAVFAQPFRTNTADVKIFRVSKENEGIYVCH
                     GSNDAGEDQQYIRVEVQPRRGDVGAGGDDNGDVDTRQPPNRPQIQPNPLSNERLTTEL
                     GNNVTLICNVDNVNTEWERVDGTPLPHNAYTVRNTLVIVFVEPQNLGQYRCNGIGRDG
                     RVEAHVVRELVLLPLPRITFYPNIPLTVELGQNLDVYCQVENVRPEDVHWTTDNNRPL
                     PSSVRIEGNVLRFASITQAAAGEYRCSATNQYGSRSKNARVVVKQPSGFQPVPHSQVQ
                     QRQVGDSIQLRCRLTTQYGDEVRGNIQFNWYREDGSPLPRGVRPDSQVLQLVKLQPED
                     EGRYICNSYDLGSGQQLPPVSIDLQVLTVPAAPQNPIYLPPVAPPRSPERILEPQLSL
                     SVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAPLSENVQQVGNNLVISNVASTDA
                     GNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIVYAKVGGNADLQCGADEDRQPSY
                     RWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCSAQYSDGETVDFPNILVVTGAIP
                     QFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGLLLFNGQTRGSGDYIALSLKDRY
                     AEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRDGYIQVDDQHPVAFPTSQHQQIP
                     QLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISRLTLQGRTVELIREAKFKEGITD
                     CRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRDCAIEGTQCTAGVCGSGRCENTE
                     NDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAAYGTPKVTKVNITLSVRPASLED
                     SVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPVVVRSAEPLPLNRWTRIEIR
                     RRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVGGVDRSTVKINRDVNITKGFDGC
                     ISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDEYEMPVALPSPKVAENERQLMAP
                     CASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHLQLSFNASFRGDGYVELNRSHFQ
                     PALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIAAAVVDGYVEYSMRLDGE
                     EAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQILDTGDTRPTINKAMKLPGNVFVG
                     GAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSSAAINGVNANVCPANDEPLGGTE
                     PPVV"
     misc_feature    458..>715
                     /gene="trol"
                     /note="Coiled-coil domain-containing protein 66; Region:
                     CCDC66; pfam15236"
                     /db_xref="CDD:434558"
     misc_feature    1460..1561
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1475..1477,1496..1498,1529..1534)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1508..1510,1517..1519,1529..1531,1547..1552)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1538..1552
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1718..1816
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(1736..1738,1760..1762,1793..1798)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1772..1774,1781..1783,1793..1795,1811..1816)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1802..1816
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1838..1945
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1853..1855,1880..1882,1913..1918)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1892..1894,1901..1903,1913..1915,1931..1936)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1922..1936
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1973..2077
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1988..1990,2012..2014,2045..2050)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2024..2026,2033..2035,2045..2047,2063..2068)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2054..2068
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2231..2338
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2246..2248,2273..2275,2306..2311)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2285..2287,2294..2296,2306..2308,2324..2329)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2315..2329
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2597..2701
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2615..2617,2639..2641,2672..2677)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2651..2653,2660..2662,2672..2674,2690..2695)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2681..2695
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2714..2821
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2729..2731,2756..2758,2789..2794)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2768..2770,2777..2779,2789..2791,2807..2812)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2798..2812
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2864..2968
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2879..2881,2903..2905,2936..2941)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2915..2917,2924..2926,2936..2938,2954..2959)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2945..2959
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3023..3127
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3038..3040,3062..3064,3095..3100)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3074..3076,3083..3085,3095..3097,3113..3118)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3104..3118
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3146..3247
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3161..3163,3182..3184,3215..3220)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3194..3196,3203..3205,3215..3217,3233..3238)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3224..3238
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3254..3358
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3269..3271,3293..3295,3326..3331)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3305..3307,3314..3316,3326..3328,3344..3349)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3335..3349
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3371..3472
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3386..3388,3407..3409,3440..3445)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3419..3421,3428..3430,3440..3442,3458..3463)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3449..3463
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3518..3616
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(3536..3538,3560..3562,3593..3598)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3572..3574,3581..3583,3593..3595,3611..3616)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3602..3616
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3668..3769
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3683..3685,3704..3706,3737..3742)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3716..3718,3725..3727,3737..3739,3755..3760)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3746..3760
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3797..3889
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3800..3802,3824..3826,3857..3862)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3836..3838,3845..3847,3857..3859,3875..3880)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3866..3880
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3890..3994
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3905..3907,3929..3931,3962..3967)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3941..3943,3950..3952,3962..3964,3980..3985)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3971..3985
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4010..4114
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4025..4027,4049..4051,4082..4087)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4061..4063,4070..4072,4082..4084,4100..4105)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4091..4105
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4205..4312
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4220..4222,4244..4246,4277..4282)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4256..4258,4265..4267,4277..4279,4298..4303)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4289..4303
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4379..4585
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    4679..4783
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4694..4696,4718..4720,4751..4756)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4730..4732,4739..4741,4751..4753,4769..4774)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4760..4774
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4799..4903
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4814..4816,4838..4840,4871..4876)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4850..4852,4859..4861,4871..4873,4889..4894)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4880..4894
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4928..5032
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4943..4945,4967..4969,5000..5005)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4979..4981,4988..4990,5000..5002,5018..5023)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    5009..5023
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    5084..5311
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    5093..5107
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    5132..5146
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    5201..5215
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    5243..5260
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    5285..5296
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    5606..5998
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    6167..6328
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(6167..6169,6173..6175,6209..6211,6239..6241,
                     6245..6247,6272..6274)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    6701..7111
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <7112..7192
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    7214..7363
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(7217..7219,7223..7225,7244..7246,7265..7267,
                     7274..7276,7301..7303)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <7472..7564
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    7760..8164
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    8441..8689
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8474..8488
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    8522..8536
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    8579..8593
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    8621..8638
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    8666..8677
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <8768..8929
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    9020..9271
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9053..9067
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    9092..9106
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    9161..9175
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    9203..9220
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    9308..9550
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    9359..9373
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    9398..9412
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    9455..9469
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    9497..9514
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    9536..9547
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    9602..9832
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    9626..9640
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    9665..9679
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    9728..9742
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    9770..9787
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    9809..9820
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    9869..10132
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9899..9913
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    9938..9952
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    10070..10087
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    10505..10735
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    10532..10546
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    10571..10585
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    10631..10645
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    10673..10690
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    10769..>10972
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    10802..10816
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    10850..10873
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    10919..10933
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    11132..11338
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    11204..11218
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    11267..11278
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    11306..11323
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    11408..11608
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    11432..11446
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    11471..11485
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    11528..11542
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    11570..11587
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    11672..12115
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    12182..12280
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    12422..12883
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    13043..13141
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    13166..13627
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      14426
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attaggttgc gcgccatcgt tccaggcggt cgcacattcc acgtgccata gccgtaacaa
       61 caacctgcca accgcttaaa accaaactca aatacgaacc gaaactgcct tcacacacac
      121 aagtacctaa accaaatcta aatagctgcc aaaagaaacc aaaaattcca gagacgtcgt
      181 agcatccgtt ccccggaaga agaagaagat gggatcgccg ggatcccaag cgcccgcgat
      241 cgcgatcggg atcagtaacg ggcggagagg tcacacgggg tcgctgctcc tgcgcctcct
      301 tctcgtggcc ttcgtcctca acgcctgcca cgtacccccg accaatgcca agcaaattac
      361 gaaaagtaaa gttgatgacc aggactttat actggccgac acacaatcgc tgcagggcag
      421 cgttgacctt gacgatgacg aagcgttcct gattcctccg gattccgaag agaagttgga
      481 taagaagttc acgccggagg gcaactggtg gagccagggg ctccatcgtg ttcgccgctc
      541 cctaaatagc ttcttcggct ccgacgacga tgatcaggaa aaggaacgtg agcgtcagag
      601 gcaaaggcaa aataatcgcg atgccgccaa ccggcaaaag gaacttcggc gccagcaaaa
      661 ggagagccag aaccgcgaga agcagctgcg attggagcgc caggagaggc agcgccttgc
      721 caagcggaac aatcacgtgg tcttcaatcg cgtcaccgat ccccgcaagc gggcatccga
      781 cctttacgac gagaacgagg catctggcct aaacgaggag gaaaccacca cctatcgcac
      841 ctactttgtt gttaatgagc catattcaga cgactacaag gagcgggaca gcctccagtt
      901 ccagaatctg caaaaacttc ttgacgagga cctgcgcaac ttcttcaatc gcaatttcga
      961 aaataacgat gatgaagagc aggaaatcca tagcacccta gagcgagtcg atcaaaccaa
     1021 ggaccatttt aaaattcgcg tgcaacttag ggtagatctg cccagttcaa tcaacgactt
     1081 tggaagtaag ttggagcaac aactgaatgt ctacaagcga atcgatcgtt tgggtgccag
     1141 taccgatggc gtcttcacct ttaccgaatc gagcgtctac aaatacgaac accaatacga
     1201 tattgtgaca ccgagagtaa ttgtatctgg acaaccgata actgaaaaac cagtcgaagc
     1261 accccaagaa ttcgatgagg atcctatcga agttgcattg cccacggatg aggtggaggg
     1321 ctccggccaa gattccggta gctgtcgcgg cgatgccacc ttccagtgtc gaaggagtgg
     1381 aaagactatt tgcgatgaaa tgcgatgcga tggatctcgc gattgtcccg atgccgagga
     1441 cgaggaaggc tgcgaggttt gcaacgaact tcagttcaag tgcgataaca agtgtctgcc
     1501 gctcaataag cgctgcgata atcgatacga ttgtgaggat cagacggacg aggctggttg
     1561 tcaacggtac gaagtagaag agtctcagcc tcagccgcag ccgcaacctc agcctgaacc
     1621 ggaacctgaa cctgaacctg agcctgagcc tgaacctgaa ccagaaccag aacctgaaga
     1681 gcctataaca gacaatgaac agcctgagca aaactcagaa tgccgggcca ccgagttcag
     1741 atgcaacaat ggggactgca tcgatattag aaagcgttgc gatcacattt cggactgtag
     1801 cgaaggcgag gacgagaacg aggagtgccc cgccgcctgc agcggaatgg agtatcaatg
     1861 tcgcgacggc acgcgctgca taagtttgag tcagcagtgc gacggtcatt ccgattgcag
     1921 cgacgccgac gacgaggagc attgcgacgg aagtggtaac gatggtgagg attgtcggtt
     1981 cgatgagttc cgttgcggaa ctggtgagtg cataccgatg cgtcaggtgt gcgataacat
     2041 ctacgattgc aacgattatt ccgatgaggt cagctgcgcc gaggaggagg aagatagtgt
     2101 gggcataccc attggccgtc caccgcagag gccagcgccc aaacacgact ggctggacga
     2161 attggacgcc aatgagtacc acgtctatca tccaagtaat gtctatgagt tggccaattc
     2221 caagaatccc tgtgccagca atcaatttcg ctgcgccacc acgaatgtgt gcatccccct
     2281 gcatttgcgt tgcgataatt tctatcactg caacgatatg agcgatgaga aggactgcga
     2341 gcagtatcaa cgacgcacca ccaccaccac ccgacgacct tcgacctcgg cccggccctc
     2401 cttcaccttc accttcacga cccaggggcc aggcttgctg gagcgtcgca atagcaccac
     2461 cagtagaacc accgcaggca gcaccaccag agccaccgaa gcaccacaat ggccatgggc
     2521 aaccagaccc accgagacca cgaccactaa cccaataaca acagttggcg tagcgagcag
     2581 ctcacctcag tcctcctgtc tcgaaaacat cgaattcgcg tgtcacaatc gcgattgcat
     2641 tccgattgag agcgtctgcg atggcacccc cgactgcgga cgcagtgaag acgaggacga
     2701 cgctctttgc aagtgcaccg ccgacaagta caaatgccaa cacggcggag gctgcattcc
     2761 gaaaacccag gtgtgcgatg gcaaacctca gtgccgcgac cgcagcgacg agagcgcctg
     2821 ccatctcaat ggaagattaa ataagactcg tttgggggtc cagtgccagg aaaaccagta
     2881 tcaatgtggc gatggaagct gcatctccgg ctacaaacgc tgcaatggca tcaacgattg
     2941 cgccgatgac gccgacgaat ataactgcat ctacacctac aacgaagact acgtagaccc
     3001 ggacgacaat ccattgaatg aatgtgatat ccttgagttt gaatgtgact acagtctgtg
     3061 tttaccgcta gagaagaaat gcgatggcta tgcagactgt gaagacttga gcgacgagtt
     3121 cgagtgtcag tcgtacacag agaattgtct attgtctgag ttcgaatgcg atggctactg
     3181 cctgccccgc gatcagttat gcaacggaat aatcaattgc caagatggca gcgacgagcg
     3241 caactgtacc ttttgccggg aagatgccta cctctgcacc accggcgagt gtgtggccgt
     3301 aaatcagaga tgcaacggca tcgtcgaatg cgccgatggc agcgacgagc gtcactgcgc
     3361 caggatatat tgtccaccta ataggctggc ctgcaacggc cgatgcgtca gtcggagaat
     3421 taggtgtgat ggcaaacgcg attgcctcga tggctacgac gagatgtatt gtccggagac
     3481 caactaccat tatcccacac acaatcctaa accaaaaacc tgccgaaccc acgagtggca
     3541 gtgtacgaat ctcgagtgca tcgagatgag attgaagtgc gatgatgttc cggattgctc
     3601 ggatggatcc gatgaggacc tcagcatttg cttcggcacg gccaccacac gactaaagcc
     3661 cagcgactgc ggtccggatc agttcttctg cgatgattta tgctataatc gctctattcg
     3721 atgcaatggc catatggatt gctcagatgg cagtgatgag atcgcttgta gctcgctgtc
     3781 agtgcttcca tgtccacagc accagtgtcc cagtggcagg tgttattcgg aaagtgagcg
     3841 atgcgatcgc cacaggcact gcgaggatgg ctccgatgag gccaactgct gttacgcgga
     3901 tcaattccgc tgcaataatg gtgactgcat tgcggaatcg gctcattgcg atggaaatat
     3961 cgattgtagc gaccagtccg atgaactcga ctgcggagga gactcgcagt gtctgcccaa
     4021 ccaattccgc tgcaagaatg gccaatgtgt gagctctaca gcgcgttgca acaagcgttc
     4081 cgattgtttg gatggctccg atgagcagaa ttgtggtcat catcatgttg aggtcagccc
     4141 aggaagcact ggaagtacca gcaccaccac tagcaccact gccatgacgc ctctgagaat
     4201 catctgtcca ccaacctcat ttaaatgcga aaatggaccc tgtatttcgc tgggcctcaa
     4261 gtgcaacgga cacgtcgatt gtccgtatga tagtagcgat gaggcggatt gtggccaaat
     4321 cagcaatgac attgatccca atgaacctaa caactccgga cgtggaacga accaattgaa
     4381 actcaagacc tatcccgaca accaaatcat taaggagagt cgtgaggtca tcttccgttg
     4441 ccgtgacgaa ggtcccaacc gcgccaaggt caagtggtcg cgacccggcg gacgtcccct
     4501 gccccccggt ttcaccgatc gcaatggccg cctggagatc cccaacatca gggtggagga
     4561 tgctggcgcc tatgtctgcg aggccgtggg ctatgccaac tatattcccg gtcagcacgt
     4621 caccgtaaac ctcaacgtcg agcgcttaaa cgaacgcgaa atccgtccgg actcagcctg
     4681 tacggagtac caggccacct gcatgaacgg cgagtgtatc gataagtcgg gcatctgcga
     4741 tggacatccg gactgttcgg atggctccga tgagcacagc tgcagtttgg gtttgaagtg
     4801 tcagcccaac cagttcatgt gctccaattc caagtgtgtg gatcgcacct ggcgctgtga
     4861 tggcgagaac gactgcggcg ataactccga tgagacctct tgcgatccgg aaccaagtga
     4921 tgctccgtgc cgatacgacg aattccagtg ccgcagcggt cattgcattc ccaagagctt
     4981 ccagtgcgac tatatgaacg attgtaccga tggtaccgat gaaattggat gctcggtgcc
     5041 ctctccaatg accctacccg caccctcgat tgtcgtgatg gagtacgagg tcctcgagct
     5101 gacctgcgtg ggcaccggcg tcccgacgcc gacgatcgtg tggcgtctca actggggcca
     5161 tgtgcccgag aagtgtgaat cgaagagcta cggcggaacc ggaaccctgc gctgtccgaa
     5221 catgaggccc caggacagtg gtgcctactc gtgcgagttc atcaacacac gcggcacctt
     5281 ctatccgaaa acgaactcga ttgtcaccgt tacgccggtg cgctcggatg tctgcaaggc
     5341 cggattcttc aatatgctgg cccgcaagtc ggaggaatgc gtccagtgct tctgctttgg
     5401 cgtttcgacc aactgtgaca gtgccaattt gttcacctac gccattcagc caccgatcct
     5461 ttcgcaccgc gtggtcagcg ttgaactcag tccgttccgt caaattgtca tcaatgaggc
     5521 tagtccgggt caggatctgc tcaccttgca ccatggtgtt cagttcaggg catcgaacgt
     5581 acactacaac ggccgggaga caccattctt ggccctgccc gctgagtata tgggcaacca
     5641 gctgaagtcc tatggcggca atctgcgcta cgaggtcagg tacaatggca acggtagacc
     5701 ggtcagcgga cccgatgtca tcatcaccgg caacagtttc acgctaaccc atcgcgttcg
     5761 cactcatccg ggtcagaaca acagggtgac tattcccttc ctgccgggag gctggacgaa
     5821 gccggatggt cgcaagggaa cgcgagagga catcatgatg atactggcca atgtggacaa
     5881 tattctgatt cgactgggct acctggatag cacagctcgc gaagtggatc tgataaatat
     5941 cgccttggat tcggccggaa gtgccgatca gggattgggc agtgcctcgc tcgtggagaa
     6001 gtgcacctgt ccgcccggct atgttggtga ttcgtgcgag tcctgtgcct cgggctatgt
     6061 tcgccaggcc cgcggacctt ggctgggtca ttgtgtgccc ttcaccccgg aaccgtgccc
     6121 agcgggaacc tacggcaatc cccgacttgg tgttccctgc caggagtgtc cgtgccccca
     6181 cgcgggcgcc aataactttg ccagcggctg ccaacagagt cccgatggcg atgtgatttg
     6241 ccgctgcaac gaaggctatg ccggcaagag gtgcgagcac tgcgcccagg gttaccaggg
     6301 taatccgttg gcaccgggag gagtctgtcg caagataccc gatagttcgt gcaatgtcga
     6361 cggcacctac aacatctaca gcaatggaac gtgccagtgc aaggatagcg tgattggcga
     6421 acagtgcgac acctgcgcgc cgaagagttt ccacctcaat tcgttcacct acaccggttg
     6481 catcgagtgc ttctgcagtg gagtgggctt ggattgtgac agtagttcgt ggtatcgcaa
     6541 ccaggtcacc agcacctttg gacgaacgcg cgtcaatcat ggattcgccc tgattagcga
     6601 ctatatgcgc aataccccgg taacggtgcc cgtttccatg tccacccagg ccaatgcctt
     6661 gagcttcgtg ggatccgccg agcaggccgg taatacgctc tactggagtc ttcccgccgc
     6721 cttcctgggc aacaagctga cctcgtacgg aggcaagttg agctacacgc tcagctacag
     6781 tcccctgccc agcggcatta tgtcgcgcaa cagtgccccc gatgtggtga tcaagagcgg
     6841 cgaggatctg aggctcatcc attacaggaa gtcgcaggtc agtcccagtg tggccaacac
     6901 ctatgccgtg gagatcaagg agagcgcatg gcagcgcggc gatgaactgg tgcctaaccg
     6961 tgaacacgtc ctgatggccc tcagcaatat tacggccatc tatatcaagg ccacgtacac
     7021 gactagcacc aaggaggcct cgctgcgatc ggtcacattg gatacggcca cggccaccaa
     7081 tctgggcacc gcacgtgccg tcgaagtgga gcagtgccgc tgtcccgagg gctatttggg
     7141 tctctcctgc gagcagtgtg ctcctggcta tacgcgcgat ccggaggcag gaatctatct
     7201 gggtctctgc aggccctgcg agtgcaatgg acattccaag tattgcaaca gtgagacagg
     7261 cgaatgcgaa agctgttccg acaacaccga aggattcaat tgtgaccgat gcgccgccgg
     7321 ctatgtgggt gatgccaccc gaggaacttc gtacgactgt caatacgatg acggcggcta
     7381 tccgacgtcg cgtccaccgg caccgggcaa tcagacggcc gaatgcctgg tgaattgcca
     7441 acaggaggga accgccggtt gccgcggcta ccagtgcgag tgcaagagga atgtggctgg
     7501 cgatcgatgc gatcagtgcc gccccggaac ctatggactg tcggcccaaa atccggacgg
     7561 ttgcaaggag tgctactgct ccggactgac caaccagtgc cgctcggcgt ctctctaccg
     7621 ccagctgata cccgtggact tcatttcgac gccaccattg ataacagacg aattcggcga
     7681 catcatggat agggataacc ttgtgcccga cgtgcccagg aatgtgtata cctacaagca
     7741 cacctcctac acgcccaagt actggagcct gaggggtagt gtgctgggca accagctgtt
     7801 gtcgtacggc ggccgcttgg agtacagcct gattgtggag tccgttggcc gggaccatcg
     7861 tggcaaggat gtggtcctaa ttggcaacgg actcaagctg atctggtcgc gacccgatgg
     7921 ccatgacaac gagcaggaat accatgtgcg tttgcatgag gacgagcagt ggacggttga
     7981 ggatcgtgga tcggcacgac aggccacgcg ggccgacttc atgactgtgc tgtcggatct
     8041 gcagcacatc ctgatcctgg ccacacccaa ggtgcccacg gtcagcacct cgattagcaa
     8101 tgtcatcctg gagagttcga taaccacgag agcgcctgga gctacgcatg cctccgatat
     8161 cgagttgtgc cagtgtccat ccggttatac gggcacttcc tgtgagtcct gcgcaccact
     8221 gcactaccgc gacgcctctg gacgctgcag tcagtgtcct tgcgacgctt ccaacacgga
     8281 atcctgcggc ttggtcagcg gcggtaacgt cgaatgccag tgcaggccac gctggagggg
     8341 tgatcgctgc cgggaaattg aaactaacga accgactccg gaaccggata ccagtaccga
     8401 tgatcccgtg cgcacccaga tcatagtgtc gattgccagg ccagagatta ccattctgcc
     8461 cgtgggtgga tcgctgaccc tcagctgtac cggtcgaatg cgctggacca atagcccagt
     8521 gtttgtgaac tggtacaagc agggcagtca cctgcccgag ggagtcgagg tgcaaggcgg
     8581 taatctgcag ctgttcaacc tgcagatcag cgattctgga atctacatct gccaggccgt
     8641 aagcaacgag accggccaca gctttacgga ccacgtctcc atcaccgttt cccaggagga
     8701 ccaacgctcg ccggctcaca ttgtggattt gcccaacgac gtgaccttcg aggagtacgt
     8761 aagcaatgag atcgtctgcg aggtggaggg caacccacca cccactgtca cctggactcg
     8821 cgtggatggc catgcggacg cccaaagtac gcgaacggac aacaatcggc tggtcttcga
     8881 ttcgccgagg aaatcggacg agggtcgcta tcgctgccag gcagagaata gcctgagtcg
     8941 ggaggagaag tacgtagtcg tgtatgtccg gagcaatcct ccccagccgc cgccgcagca
     9001 ggatcgtttg tacatcacac cgcaggaggt gaacggtgtg gccggtgact ccttccagtt
     9061 gtcctgccaa ttcaccagcg ctgcctctct gcgctacgat tggtcccacg atggtcgctc
     9121 cctgtccgcg tcgtcacccc gaaatgttgt ggtccgcgga aatgtcctgg aagtccgcga
     9181 tgccaacgtt cgcgactccg gcacctacac ctgtgtggcc ttcgacctgc gcacccgacg
     9241 caacttcacc gagagcgcac gggtctacat cgagcagccc aacgagccgg gaatccttgg
     9301 cgacaagccg catatcttga ccttggagca gaacatcata attgtgcaag gcgaggactt
     9361 gagcatcaca tgtgaggcaa gtggaacgcc ctatccctcg attaagtgga ccaaggtgca
     9421 ggagaatctg gccgaaaatg tccgcatcag tggcaatgtg ctcaccatct acggaggccg
     9481 cagtgagaat cgtggtcttt actcctgcat cgccgagaac tctcacggca gcgatcagtc
     9541 cagcacaagc atcgatattg aaccccggga gcggccgagt cttacgattg atacggccac
     9601 ccaaaaggtt tcggttggct cccaggcgtc cctttactgt gccgcccagg gcattcccga
     9661 accgaccgtc gagtgggttc gaacggatgg tcagccactg tcgccgcgtc acaaggtcca
     9721 ggcacccggc tatgttgtga tcgatgacat tgtgctcgat gatagcggta cctacgagtg
     9781 ccgggcgagc aacatagctg gccaggtgag cggcttggcc accattaacg tccaggagcc
     9841 aactcttgtg cggatcgaac cagataggca acaccatatc gtcacccagg gcgacgaact
     9901 ctcgctcagc tgcgtgggca gtggcgtccc tactccttcg gtcttttgga gtttcgaggg
     9961 aagagacgtt gacaggatgg gagtaccgga aggtgctgtt tttgcgcaac ctttccgaac
    10021 caacactgcc gacgtgaaaa tcttccgggt gagcaaggag aacgaaggca tctacgtctg
    10081 tcacggatcc aatgacgcgg gtgaagatca acaatacatt cgcgtggagg tacaacccag
    10141 acggggtgac gtcggtgcag gaggagatga caatggtgat gtcgataccc gacagccccc
    10201 caatcggccc caaatccaac cgaatccatt gagcaacgaa cgcctgacca ccgaattggg
    10261 caacaatgtg accctcatct gcaacgtgga caacgtgaac acggaatggg aacgcgtcga
    10321 tggcacaccc ctgccgcaca atgcctacac ggtgagaaat acgctggtga ttgtcttcgt
    10381 ggagccgcag aatctgggtc agtaccgctg caatggaatc ggtcgcgatg gacgtgtgga
    10441 ggcccatgtg gtgagggagc tggttctcct gcccctgccc aggatcacct tctatcccaa
    10501 catcccgctg accgtggagc tgggccagaa cttggatgtc tactgccagg tggagaacgt
    10561 gcgtccggag gacgtgcatt ggaccaccga caacaatcga ccactgccca gttccgtacg
    10621 catcgagggc aatgtcctca ggttcgcgtc catcactcag gctgctgccg gtgaataccg
    10681 ctgctcggcc accaatcaat atggaagccg atcgaagaac gccagggtgg tggtgaaaca
    10741 gcccagtggc ttccagcccg ttccccactc gcaggtgcaa cagcgtcagg tgggcgactc
    10801 catccagttg cgatgccgcc tgaccaccca gtacggcgac gaggttcgcg gcaatatcca
    10861 gttcaactgg taccgtgagg acggcagccc cttgccccgc ggtgtccgtc cggatagcca
    10921 ggtgctgcag ctggttaaat tgcagcccga ggacgagggc cgctacatct gcaactcgta
    10981 cgatttgggc agcgggcagc aactgccccc cgtctccatc gacttgcaag tactaacggt
    11041 accagcggct ccccagaacc ccatctacct gccgccagtg gcgccaccac gttcgcccga
    11101 aaggatcctc gagccccaac tgagcctgag tgtacaatcc tcgaacctgc cagccggcga
    11161 cggcaccacc gtcgagtgct tctcctccga tgactcctac ccagatgtcg tgtgggaacg
    11221 cgccgatgga gctccactca gcgaaaatgt ccagcaagtg ggcaataacc tggtgattag
    11281 taacgtggcc tccaccgatg ccggtaacta tgtgtgcaag tgcaagacgg acgagggaga
    11341 tctgtatacc accagctaca aactggaggt cgaggagcag ccccatgaac tgaagagctc
    11401 caagatagtc tacgccaagg ttggcggaaa tgccgacttg cagtgcggag ccgatgaaga
    11461 tcgacagccc agctaccgtt ggtctcgcca atacggacaa cttcaggcgg gacgcagtct
    11521 gcagaatgag aaactttcgt tggatcgcgt tcaggccaac gatgccggaa cttatgtttg
    11581 ttcggcccaa tacagcgatg gcgagacggt tgacttcccc aacattctgg ttgtgaccgg
    11641 ggcgattccc cagttccgcc aggagccccg cagctacatg agcttcccca cgctctcgaa
    11701 ctcctcgttc aagttcaact tcgagctgac cttccggccg gaaaacgccg acggactgct
    11761 gctcttcaat ggacagaccc gcggaagcgg tgactatatc gcactctcgc tgaaggatcg
    11821 ctatgcggag ttccggttcg attttggcgg taaaccgttg ctggtgcgag cggaggagcc
    11881 actggctttg gatgaatggc acacggtgcg cgtgagtcgc ttcaagcggg atggctacat
    11941 ccaggtggac gaccagcatc cggtggcctt ccccacctcc cagcatcagc agatacccca
    12001 gttggaactg attgaggatc tgtacattgg cggcgtgccc aactgggagt tcctgcccgc
    12061 cgaggcggtg ggtcagcaat caggcttcgt gggctgcatt agccggctga ccctgcaggg
    12121 acgcaccgtg gagctgatcc gggaggccaa gttcaaggag ggcatcaccg attgccggcc
    12181 ctgcgcccag ggaccctgcc agaacaaggg cgtctgcctg gagagccaga cggagcaggc
    12241 ctacacctgc gtctgccagc cgggctggac tggccgggat tgtgccatcg agggcaccca
    12301 gtgcaccgca ggagtttgcg gctcgggacg ctgcgagaat acggagaacg acatggagtg
    12361 cctgtgcccg ctgaacaggg caggcgatcg atgccagtac aatgagattc taaatgaaca
    12421 gagcttgaat ttcaagagca acagctttgc ggcctacgga actcccaagg tcaccaaagt
    12481 aaacatcaca ctctccgttc gtcccgcgag cctggaggac tctgtgatcc tgtacacggc
    12541 ggaatccact ctgcccagcg gcgattacct ggctttggtc cttcgcggtg gccacgcgga
    12601 gctgctgatc aacacggccg cccgcttgga tcccgtggtg gtgcgttcgg cggaaccgct
    12661 gcccctcaat cgctggacca gaatcgagat caggcgtcgc ctgggcgagg gaatcctcaa
    12721 ggtgggcgat ggacccgagc gaaaggccaa ggcaccggga tccgatcgca ttctgtcgct
    12781 caagacccac ctctttgtgg gcggcgtcga tcggtcgacc gtaaagatca accgtgatgt
    12841 gaacatcacc aagggcttcg atggctgcat ctcgaagctg tacaactcgc agaaatccgt
    12901 caatctgctg ggtgacatca gggatgcggc gaatgtccag aactgtgggg aggcgaatga
    12961 gatagatgac gatgagtatg agatgccagt agcgctgcca tcgcctaagg tcgccgagaa
    13021 tgaacgtcag ctgatggcgc cgtgtgccag tgatccctgc gagaacgggg gaagctgcag
    13081 cgagcaggag gacatggcca tctgctcctg tcccttcggc ttcagcggca aacactgcca
    13141 gaatcacctc cagctgagct tcaatgcctc gttccgcggc gatggctacg tggagctgaa
    13201 ccgcagccac ttccaacccg ccctggagca gacgtactcc cacattggca ttgtgttcac
    13261 caccaacaag ccgaatggcc tgcttttctg gtggggccag gaggccgggg aggagtacac
    13321 cggacaggac ttcattgccg ccgccgtggt cgatggctat gtggagtact cgatgaggct
    13381 cgatggcgag gaggcggtca ttcggaacag cgatatccgc gtggacaatg gcgagcggca
    13441 cattgtgatc gccaagcggg atgagaacac cgccatgctg gaactcgatc agatcctgga
    13501 cacgggcgat acgcgaccca ccatcaacaa ggcaatgaag ctgccgggca atgtgtttgt
    13561 cggtggcgct cctgatgtcg cggcattcac gggcttccgc tacaaggaca atttcaacgg
    13621 ctgcattgtg gtcgtcgagg gcgaaaccgt gggccaaatt aaccttagtt cagctgccat
    13681 caatggagtg aatgccaacg tgtgtcccgc taacgacgaa cctctgggag gaaccgaacc
    13741 gccagtcgtc tgaggacaca accagcaacc gaaattagct ttttaattaa acattaacaa
    13801 atgaaacaaa aagaaaaaca atttttatat atacaacata tgaataagcc ccaagcaaac
    13861 ctacaaaaaa ttgaatatta tacgacgaac agataatata aaaacaaaaa aagagagaaa
    13921 cgatcacttc tactacaatt gcttcttcga tccttaagtc taggttaaag attgtagcaa
    13981 gaaaacaagc gaatatcaca aacatttatt taacaagaac gccatgcgag aagtgaaacg
    14041 aaacagaaac aataatgcaa ttaatgcaga taatacagat aaagcctaga accctaagaa
    14101 ctaactaact aactcgaaca agaacaacaa cgcatactag ccaactgcaa ccacaacaac
    14161 cacaatagtg aaggcatttt aattataatt ttagtctcta gcttataact atgactacga
    14221 ctcgtttttt ttgtgagccc agtgtaaaat gttggaaatc ggaaattggc cctacacaca
    14281 aacacacaca agttattaat taaataccaa ttgataccat ataatgataa atgaaatact
    14341 atgaatgcaa ctattgtgaa cgaacgaaaa ccgttgagtg gataaaaagc ataagcagaa
    14401 gatatattaa aatgaaatca acaaca