Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_070218418           14375 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X1, mRNA.
ACCESSION   XM_070218418
VERSION     XM_070218418.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..14375
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..14375
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 9
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             209..13702
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X1"
                     /protein_id="XP_070074519.1"
                     /db_xref="GeneID:108055788"
                     /translation="MGSPGSQAPAIAIGISNGRRGHTGSLLLRLLLVAFVLNACHVPP
                     TNAKQITKSKVDDQDFILADTQSLQGSVDLDDDEAFLIPPDSEEKLDKKFTPEGNWWS
                     QGLHRVRRSLNSFFGSDDDDQEKERERQRQRQNNRDAANRQKELRRQQKESQNREKQL
                     RLERQERQRLAKRNNHVVFNRVTDPRKRASDLYDENEASGLNEEETTTYRTYFVVNEP
                     YSDDYKERDSLQFQNLQKLLDEDLRNFFNRNFENNDDEEQEIHSTLERVDQTKDHFKI
                     RVQLRVDLPSSINDFGSKLEQQLNVYKRIDRLGASTDGVFTFTESSVYKYEHQYDIVT
                     PRVIVSGQPITEKPVEAPQEFDEDPIEVALPTDEVEGSGQDSGSCRGDATFQCRRSGK
                     TICDEMRCDGSRDCPDAEDEEGCEVCNELQFKCDNKCLPLNKRCDNRYDCEDQTDEAG
                     CQRYEVEESQPQPQPQPQPEPEPEPEPEPEPEPEPEPEPEEPITDNEQPEQNSECRAT
                     EFRCNNGDCIDIRKRCDHISDCSEGEDENEECPAACSGMEYQCRDGTRCISLSQQCDG
                     HSDCSDADDEEHCDGSGNDGEDCRFDEFRCGTGECIPMRQVCDNIYDCNDYSDEVSCA
                     EEEEDSVGIPIGRPPQRPAPKHDWLDELDANEYHVYHPSNVYELANSKNPCASNQFRC
                     ATTNVCIPLHLRCDNFYHCNDMSDEKDCEQYQRRTTTTTRRPSTSARPSFTFTFTTQG
                     PGLLERRNSTTSRTTAGSTTRATEAPQWPWATRPTETTTTNPITTVGVASSSPQSSCL
                     ENIEFACHNRDCIPIESVCDGTPDCGRSEDEDDALCKCTADKYKCQHGGGCIPKTQVC
                     DGKPQCRDRSDESACHLNGRLNKTRLGVQCQENQYQCGDGSCISGYKRCNGINDCADD
                     ADEYNCIYTYNEDYVDPDDNPLNECDILEFECDYSLCLPLEKKCDGYADCEDLSDEFE
                     CQSYTENCLLSEFECDGYCLPRDQLCNGIINCQDGSDERNCTFCREDAYLCTTGECVA
                     VNQRCNGIVECADGSDERHCVVNTTETNYHYPTHNPKPKTCRTHEWQCTNLECIEMRL
                     KCDDVPDCSDGSDEDLSICFGTATTRLKPSDCGPDQFFCDDLCYNRSIRCNGHMDCSD
                     GSDEIACSSLSVLPCPQHQCPSGRCYSESERCDRHRHCEDGSDEANCCYADQFRCNNG
                     DCIAESAHCDGNIDCSDQSDELDCGGDSQCLPNQFRCKNGQCVSSTARCNKRSDCLDG
                     SDEQNCANEPNNSGRGTNQLKLKTYPDNQIIKESREVIFRCRDEGPNRAKVKWSRPGG
                     RPLPPGFTDRNGRLEIPNIRVEDAGAYVCEAVGYANYIPGQHVTVNLNVERLNEREIR
                     PDSACTEYQATCMNGECIDKSGICDGHPDCSDGSDEHSCSLGLKCQPNQFMCSNSKCV
                     DRTWRCDGENDCGDNSDETSCDPEPSDAPCRYDEFQCRSGHCIPKSFQCDYMNDCTDG
                     TDEIGCSVPSPMTLPAPSIVVMEYEVLELTCVGTGVPTPTIVWRLNWGHVPEKCESKS
                     YGGTGTLRCPNMRPQDSGAYSCEFINTRGTFYPKTNSIVTVTPVRSDVCKAGFFNMLA
                     RKSEECVQCFCFGVSTNCDSANLFTYAIQPPILSHRVVSVELSPFRQIVINEASPGQD
                     LLTLHHGVQFRASNVHYNGRETPFLALPAEYMGNQLKSYGGNLRYEVRYNGNGRPVSG
                     PDVIITGNSFTLTHRVRTHPGQNNRVTIPFLPGGWTKPDGRKGTREDIMMILANVDNI
                     LIRLGYLDSTAREVDLINIALDSAGSADQGLGSASLVEKCTCPPGYVGDSCESCASGY
                     VRQARGPWLGHCVPFTPEPCPAGTYGNPRLGVPCQECPCPHAGANNFASGCQQSPDGD
                     VICRCNEGYAGKRCEHCAQGYQGNPLAPGGVCRKIPDSSCNVDGTYNIYSNGTCQCKD
                     SVIGEQCDTCAPKSFHLNSFTYTGCIECFCSGVGLDCDSSSWYRNQVTSTFGRTRVNH
                     GFALISDYMRNTPVTVPVSMSTQANALSFVGSAEQAGNTLYWSLPAAFLGNKLTSYGG
                     KLSYTLSYSPLPSGIMSRNSAPDVVIKSGEDLRLIHYRKSQVSPSVANTYAVEIKESA
                     WQRGDELVPNREHVLMALSNITAIYIKATYTTSTKEASLRSVTLDTATATNLGTARAV
                     EVEQCRCPEGYLGLSCEQCAPGYTRDPEAGIYLGLCRPCECNGHSKYCNSETGECESC
                     SDNTEGFNCDRCAAGYVGDATRGTSYDCQYDDGGYPTSRPPAPGNQTAECLVNCQQEG
                     TAGCRGYQCECKRNVAGDRCDQCRPGTYGLSAQNPDGCKECYCSGLTNQCRSASLYRQ
                     LIPVDFISTPPLITDEFGDIMDRDNLVPDVPRNVYTYKHTSYTPKYWSLRGSVLGNQL
                     LSYGGRLEYSLIVESVGRDHRGKDVVLIGNGLKLIWSRPDGHDNEQEYHVRLHEDEQW
                     TVEDRGSARQATRADFMTVLSDLQHILILATPKVPTVSTSISNVILESSITTRAPGAT
                     HASDIELCQCPSGYTGTSCESCAPLHYRDASGRCSQCPCDASNTESCGLVSGGNVECQ
                     CRPRWRGDRCREIDTSPIIEEPPQICDLSRGFCCSGFQFDIAPNETISFNDTLQIYKG
                     NRIIGNMTKLRYGCPSRETNEPTPEPDTSTDDPVRTQIIVSIARPEITILPVGGSLTL
                     SCTGRMRWTNSPVFVNWYKQGSHLPEGVEVQGGNLQLFNLQISDSGIYICQAVSNETG
                     HSFTDHVSITVSQEDQRSPAHIVDLPNDVTFEEYVSNEIVCEVEGNPPPTVTWTRVDG
                     HADAQSTRTDNNRLVFDSPRKSDEGRYRCQAENSLSREEKYVVVYVRSNPPQPPPQQD
                     RLYITPQEVNGVAGDSFQLSCQFTSAASLRYDWSHDGRSLSASSPRNVVVRGNVLEVR
                     DANVRDSGTYTCVAFDLRTRRNFTESARVYIEQPNEPGILGDKPHILTLEQNIIIVQG
                     EDLSITCEASGTPYPSIKWTKVQENLAENVRISGNVLTIYGGRSENRGLYSCIAENSH
                     GSDQSSTSIDIEPRERPSLTIDTATQKVSVGSQASLYCAAQGIPEPTVEWVRTDGQPL
                     SPRHKVQAPGYVVIDDIVLDDSGTYECRASNIAGQVSGLATINVQEPTLVRIEPDRQH
                     HIVTQGDELSLSCVGSGVPTPSVFWSFEGRDVDRMGVPEGAVFAQPFRTNTADVKIFR
                     VSKENEGIYVCHGSNDAGEDQQYIRVEVQPRRGDVGAGGDDNGDVDTRQPPNRPQIQP
                     NPLSNERLTTELGNNVTLICNVDNVNTEWERVDGTPLPHNAYTVRNTLVIVFVEPQNL
                     GQYRCNGIGRDGRVEAHVVRELVLLPLPRITFYPNIPLTVELGQNLDVYCQVENVRPE
                     DVHWTTDNNRPLPSSVRIEGNVLRFASITQAAAGEYRCSATNQYGSRSKNARVVVKQP
                     SGFQPVPHSQVQQRQVGDSIQLRCRLTTQYGDEVRGNIQFNWYREDGSPLPRGVRPDS
                     QVLQLVKLQPEDEGRYICNSYDLGSGQQLPPVSIDLQVLRTTTQYPFNRFKGGVSLKD
                     TPCMVLYICAAVPAAPQNPIYLPPVAPPRSPERILEPQLSLSVQSSNLPAGDGTTVEC
                     FSSDDSYPDVVWERADGAPLSENVQQVGNNLVISNVASTDAGNYVCKCKTDEGDLYTT
                     SYKLEVEEQPHELKSSKIVYAKVGGNADLQCGADEDRQPSYRWSRQYGQLQAGRSLQN
                     EKLSLDRVQANDAGTYVCSAQYSDGETVDFPNILVVTGAIPQFRQEPRSYMSFPTLSN
                     SSFKFNFELTFRPENADGLLLFNGQTRGSGDYIALSLKDRYAEFRFDFGGKPLLVRAE
                     EPLALDEWHTVRVSRFKRDGYIQVDDQHPVAFPTSQHQQIPQLELIEDLYIGGVPNWE
                     FLPAEAVGQQSGFVGCISRLTLQGRTVELIREAKFKEGITDCRPCAQGPCQNKGVCLE
                     SQTEQAYTCVCQPGWTGRDCAIEGTQCTAGVCGSGRCENTENDMECLCPLNRAGDRCQ
                     YNEILNEQSLNFKSNSFAAYGTPKVTKVNITLSVRPASLEDSVILYTAESTLPSGDYL
                     ALVLRGGHAELLINTAARLDPVVVRSAEPLPLNRWTRIEIRRRLGEGILKVGDGPERK
                     AKAPGSDRILSLKTHLFVGGVDRSTVKINRDVNITKGFDGCISKLYNSQKSVNLLGDI
                     RDAANVQNCGEANEIDDDEYEMPVALPSPKVAENERQLMAPCASDPCENGGSCSEQED
                     MAICSCPFGFSGKHCQNHLQLSFNASFRGDGYVELNRSHFQPALEQTYSHIGIVFTTN
                     KPNGLLFWWGQEAGEEYTGQDFIAAAVVDGYVEYSMRLDGEEAVIRNSDIRVDNGERH
                     IVIAKRDENTAMLELDQILDTGDTRPTINKAMKLPGNVFVGGAPDVAAFTGFRYKDNF
                     NGCIVVVEGETVGQINLSSAAINGVNANVCPANDEPLGGTEPPVV"
     misc_feature    458..>715
                     /gene="trol"
                     /note="Coiled-coil domain-containing protein 66; Region:
                     CCDC66; pfam15236"
                     /db_xref="CDD:434558"
     misc_feature    1460..1561
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1475..1477,1496..1498,1529..1534)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1508..1510,1517..1519,1529..1531,1547..1552)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1538..1552
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1718..1816
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(1736..1738,1760..1762,1793..1798)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1772..1774,1781..1783,1793..1795,1811..1816)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1802..1816
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1838..1945
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1853..1855,1880..1882,1913..1918)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1892..1894,1901..1903,1913..1915,1931..1936)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1922..1936
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1973..2077
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1988..1990,2012..2014,2045..2050)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2024..2026,2033..2035,2045..2047,2063..2068)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2054..2068
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2231..2338
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2246..2248,2273..2275,2306..2311)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2285..2287,2294..2296,2306..2308,2324..2329)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2315..2329
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2597..2701
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2615..2617,2639..2641,2672..2677)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2651..2653,2660..2662,2672..2674,2690..2695)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2681..2695
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2714..2821
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2729..2731,2756..2758,2789..2794)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2768..2770,2777..2779,2789..2791,2807..2812)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2798..2812
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2864..2968
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2879..2881,2903..2905,2936..2941)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2915..2917,2924..2926,2936..2938,2954..2959)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2945..2959
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3023..3127
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3038..3040,3062..3064,3095..3100)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3074..3076,3083..3085,3095..3097,3113..3118)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3104..3118
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3146..3247
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3161..3163,3182..3184,3215..3220)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3194..3196,3203..3205,3215..3217,3233..3238)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3224..3238
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3254..3358
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3269..3271,3293..3295,3326..3331)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3305..3307,3314..3316,3326..3328,3344..3349)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3335..3349
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3416..3514
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(3434..3436,3458..3460,3491..3496)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3470..3472,3479..3481,3491..3493,3509..3514)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3500..3514
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3566..3667
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3581..3583,3602..3604,3635..3640)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3614..3616,3623..3625,3635..3637,3653..3658)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3644..3658
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3695..3787
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3698..3700,3722..3724,3755..3760)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3734..3736,3743..3745,3755..3757,3773..3778)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3764..3778
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3788..3892
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3803..3805,3827..3829,3860..3865)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3839..3841,3848..3850,3860..3862,3878..3883)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3869..3883
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3908..4012
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3923..3925,3947..3949,3980..3985)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3959..3961,3968..3970,3980..3982,3998..4003)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3989..4003
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4055..4261
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    4355..4459
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4370..4372,4394..4396,4427..4432)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4406..4408,4415..4417,4427..4429,4445..4450)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4436..4450
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4475..4579
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4490..4492,4514..4516,4547..4552)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4526..4528,4535..4537,4547..4549,4565..4570)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4556..4570
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4604..4708
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4619..4621,4643..4645,4676..4681)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4655..4657,4664..4666,4676..4678,4694..4699)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4685..4699
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4760..4987
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    4769..4783
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    4808..4822
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    4877..4891
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    4919..4936
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    4961..4972
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    5282..5674
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    5843..6004
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(5843..5845,5849..5851,5885..5887,5915..5917,
                     5921..5923,5948..5950)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    6377..6787
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <6788..6868
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    6890..7039
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(6893..6895,6899..6901,6920..6922,6941..6943,
                     6950..6952,6977..6979)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <7148..7240
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    7436..7840
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    8303..8551
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8336..8350
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    8384..8398
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    8441..8455
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    8483..8500
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    8528..8539
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <8630..8791
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    8882..9133
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8915..8929
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    8954..8968
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    9023..9037
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    9065..9082
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    9170..9412
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    9221..9235
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    9260..9274
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    9317..9331
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    9359..9376
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    9398..9409
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    9464..9694
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    9488..9502
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    9527..9541
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    9590..9604
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    9632..9649
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    9671..9682
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    9731..9994
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9761..9775
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    9800..9814
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    9932..9949
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    10367..10597
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    10394..10408
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    10433..10447
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    10493..10507
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    10535..10552
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    10631..>10834
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    10664..10678
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    10712..10735
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    10781..10795
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    11081..11287
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    11153..11167
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    11216..11227
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    11255..11272
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    11357..11557
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    11381..11395
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    11420..11434
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    11477..11491
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    11519..11536
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    11621..12064
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    12131..12229
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    12371..12832
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    12992..13090
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    13115..13576
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      14375
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attaggttgc gcgccatcgt tccaggcggt cgcacattcc acgtgccata gccgtaacaa
       61 caacctgcca accgcttaaa accaaactca aatacgaacc gaaactgcct tcacacacac
      121 aagtacctaa accaaatcta aatagctgcc aaaagaaacc aaaaattcca gagacgtcgt
      181 agcatccgtt ccccggaaga agaagaagat gggatcgccg ggatcccaag cgcccgcgat
      241 cgcgatcggg atcagtaacg ggcggagagg tcacacgggg tcgctgctcc tgcgcctcct
      301 tctcgtggcc ttcgtcctca acgcctgcca cgtacccccg accaatgcca agcaaattac
      361 gaaaagtaaa gttgatgacc aggactttat actggccgac acacaatcgc tgcagggcag
      421 cgttgacctt gacgatgacg aagcgttcct gattcctccg gattccgaag agaagttgga
      481 taagaagttc acgccggagg gcaactggtg gagccagggg ctccatcgtg ttcgccgctc
      541 cctaaatagc ttcttcggct ccgacgacga tgatcaggaa aaggaacgtg agcgtcagag
      601 gcaaaggcaa aataatcgcg atgccgccaa ccggcaaaag gaacttcggc gccagcaaaa
      661 ggagagccag aaccgcgaga agcagctgcg attggagcgc caggagaggc agcgccttgc
      721 caagcggaac aatcacgtgg tcttcaatcg cgtcaccgat ccccgcaagc gggcatccga
      781 cctttacgac gagaacgagg catctggcct aaacgaggag gaaaccacca cctatcgcac
      841 ctactttgtt gttaatgagc catattcaga cgactacaag gagcgggaca gcctccagtt
      901 ccagaatctg caaaaacttc ttgacgagga cctgcgcaac ttcttcaatc gcaatttcga
      961 aaataacgat gatgaagagc aggaaatcca tagcacccta gagcgagtcg atcaaaccaa
     1021 ggaccatttt aaaattcgcg tgcaacttag ggtagatctg cccagttcaa tcaacgactt
     1081 tggaagtaag ttggagcaac aactgaatgt ctacaagcga atcgatcgtt tgggtgccag
     1141 taccgatggc gtcttcacct ttaccgaatc gagcgtctac aaatacgaac accaatacga
     1201 tattgtgaca ccgagagtaa ttgtatctgg acaaccgata actgaaaaac cagtcgaagc
     1261 accccaagaa ttcgatgagg atcctatcga agttgcattg cccacggatg aggtggaggg
     1321 ctccggccaa gattccggta gctgtcgcgg cgatgccacc ttccagtgtc gaaggagtgg
     1381 aaagactatt tgcgatgaaa tgcgatgcga tggatctcgc gattgtcccg atgccgagga
     1441 cgaggaaggc tgcgaggttt gcaacgaact tcagttcaag tgcgataaca agtgtctgcc
     1501 gctcaataag cgctgcgata atcgatacga ttgtgaggat cagacggacg aggctggttg
     1561 tcaacggtac gaagtagaag agtctcagcc tcagccgcag ccgcaacctc agcctgaacc
     1621 ggaacctgaa cctgaacctg agcctgagcc tgaacctgaa ccagaaccag aacctgaaga
     1681 gcctataaca gacaatgaac agcctgagca aaactcagaa tgccgggcca ccgagttcag
     1741 atgcaacaat ggggactgca tcgatattag aaagcgttgc gatcacattt cggactgtag
     1801 cgaaggcgag gacgagaacg aggagtgccc cgccgcctgc agcggaatgg agtatcaatg
     1861 tcgcgacggc acgcgctgca taagtttgag tcagcagtgc gacggtcatt ccgattgcag
     1921 cgacgccgac gacgaggagc attgcgacgg aagtggtaac gatggtgagg attgtcggtt
     1981 cgatgagttc cgttgcggaa ctggtgagtg cataccgatg cgtcaggtgt gcgataacat
     2041 ctacgattgc aacgattatt ccgatgaggt cagctgcgcc gaggaggagg aagatagtgt
     2101 gggcataccc attggccgtc caccgcagag gccagcgccc aaacacgact ggctggacga
     2161 attggacgcc aatgagtacc acgtctatca tccaagtaat gtctatgagt tggccaattc
     2221 caagaatccc tgtgccagca atcaatttcg ctgcgccacc acgaatgtgt gcatccccct
     2281 gcatttgcgt tgcgataatt tctatcactg caacgatatg agcgatgaga aggactgcga
     2341 gcagtatcaa cgacgcacca ccaccaccac ccgacgacct tcgacctcgg cccggccctc
     2401 cttcaccttc accttcacga cccaggggcc aggcttgctg gagcgtcgca atagcaccac
     2461 cagtagaacc accgcaggca gcaccaccag agccaccgaa gcaccacaat ggccatgggc
     2521 aaccagaccc accgagacca cgaccactaa cccaataaca acagttggcg tagcgagcag
     2581 ctcacctcag tcctcctgtc tcgaaaacat cgaattcgcg tgtcacaatc gcgattgcat
     2641 tccgattgag agcgtctgcg atggcacccc cgactgcgga cgcagtgaag acgaggacga
     2701 cgctctttgc aagtgcaccg ccgacaagta caaatgccaa cacggcggag gctgcattcc
     2761 gaaaacccag gtgtgcgatg gcaaacctca gtgccgcgac cgcagcgacg agagcgcctg
     2821 ccatctcaat ggaagattaa ataagactcg tttgggggtc cagtgccagg aaaaccagta
     2881 tcaatgtggc gatggaagct gcatctccgg ctacaaacgc tgcaatggca tcaacgattg
     2941 cgccgatgac gccgacgaat ataactgcat ctacacctac aacgaagact acgtagaccc
     3001 ggacgacaat ccattgaatg aatgtgatat ccttgagttt gaatgtgact acagtctgtg
     3061 tttaccgcta gagaagaaat gcgatggcta tgcagactgt gaagacttga gcgacgagtt
     3121 cgagtgtcag tcgtacacag agaattgtct attgtctgag ttcgaatgcg atggctactg
     3181 cctgccccgc gatcagttat gcaacggaat aatcaattgc caagatggca gcgacgagcg
     3241 caactgtacc ttttgccggg aagatgccta cctctgcacc accggcgagt gtgtggccgt
     3301 aaatcagaga tgcaacggca tcgtcgaatg cgccgatggc agcgacgagc gtcactgcgt
     3361 agtcaacacc acagagacca actaccatta tcccacacac aatcctaaac caaaaacctg
     3421 ccgaacccac gagtggcagt gtacgaatct cgagtgcatc gagatgagat tgaagtgcga
     3481 tgatgttccg gattgctcgg atggatccga tgaggacctc agcatttgct tcggcacggc
     3541 caccacacga ctaaagccca gcgactgcgg tccggatcag ttcttctgcg atgatttatg
     3601 ctataatcgc tctattcgat gcaatggcca tatggattgc tcagatggca gtgatgagat
     3661 cgcttgtagc tcgctgtcag tgcttccatg tccacagcac cagtgtccca gtggcaggtg
     3721 ttattcggaa agtgagcgat gcgatcgcca caggcactgc gaggatggct ccgatgaggc
     3781 caactgctgt tacgcggatc aattccgctg caataatggt gactgcattg cggaatcggc
     3841 tcattgcgat ggaaatatcg attgtagcga ccagtccgat gaactcgact gcggaggaga
     3901 ctcgcagtgt ctgcccaacc aattccgctg caagaatggc caatgtgtga gctctacagc
     3961 gcgttgcaac aagcgttccg attgtttgga tggctccgat gagcagaatt gtgccaatga
     4021 acctaacaac tccggacgtg gaacgaacca attgaaactc aagacctatc ccgacaacca
     4081 aatcattaag gagagtcgtg aggtcatctt ccgttgccgt gacgaaggtc ccaaccgcgc
     4141 caaggtcaag tggtcgcgac ccggcggacg tcccctgccc cccggtttca ccgatcgcaa
     4201 tggccgcctg gagatcccca acatcagggt ggaggatgct ggcgcctatg tctgcgaggc
     4261 cgtgggctat gccaactata ttcccggtca gcacgtcacc gtaaacctca acgtcgagcg
     4321 cttaaacgaa cgcgaaatcc gtccggactc agcctgtacg gagtaccagg ccacctgcat
     4381 gaacggcgag tgtatcgata agtcgggcat ctgcgatgga catccggact gttcggatgg
     4441 ctccgatgag cacagctgca gtttgggttt gaagtgtcag cccaaccagt tcatgtgctc
     4501 caattccaag tgtgtggatc gcacctggcg ctgtgatggc gagaacgact gcggcgataa
     4561 ctccgatgag acctcttgcg atccggaacc aagtgatgct ccgtgccgat acgacgaatt
     4621 ccagtgccgc agcggtcatt gcattcccaa gagcttccag tgcgactata tgaacgattg
     4681 taccgatggt accgatgaaa ttggatgctc ggtgccctct ccaatgaccc tacccgcacc
     4741 ctcgattgtc gtgatggagt acgaggtcct cgagctgacc tgcgtgggca ccggcgtccc
     4801 gacgccgacg atcgtgtggc gtctcaactg gggccatgtg cccgagaagt gtgaatcgaa
     4861 gagctacggc ggaaccggaa ccctgcgctg tccgaacatg aggccccagg acagtggtgc
     4921 ctactcgtgc gagttcatca acacacgcgg caccttctat ccgaaaacga actcgattgt
     4981 caccgttacg ccggtgcgct cggatgtctg caaggccgga ttcttcaata tgctggcccg
     5041 caagtcggag gaatgcgtcc agtgcttctg ctttggcgtt tcgaccaact gtgacagtgc
     5101 caatttgttc acctacgcca ttcagccacc gatcctttcg caccgcgtgg tcagcgttga
     5161 actcagtccg ttccgtcaaa ttgtcatcaa tgaggctagt ccgggtcagg atctgctcac
     5221 cttgcaccat ggtgttcagt tcagggcatc gaacgtacac tacaacggcc gggagacacc
     5281 attcttggcc ctgcccgctg agtatatggg caaccagctg aagtcctatg gcggcaatct
     5341 gcgctacgag gtcaggtaca atggcaacgg tagaccggtc agcggacccg atgtcatcat
     5401 caccggcaac agtttcacgc taacccatcg cgttcgcact catccgggtc agaacaacag
     5461 ggtgactatt cccttcctgc cgggaggctg gacgaagccg gatggtcgca agggaacgcg
     5521 agaggacatc atgatgatac tggccaatgt ggacaatatt ctgattcgac tgggctacct
     5581 ggatagcaca gctcgcgaag tggatctgat aaatatcgcc ttggattcgg ccggaagtgc
     5641 cgatcaggga ttgggcagtg cctcgctcgt ggagaagtgc acctgtccgc ccggctatgt
     5701 tggtgattcg tgcgagtcct gtgcctcggg ctatgttcgc caggcccgcg gaccttggct
     5761 gggtcattgt gtgcccttca ccccggaacc gtgcccagcg ggaacctacg gcaatccccg
     5821 acttggtgtt ccctgccagg agtgtccgtg cccccacgcg ggcgccaata actttgccag
     5881 cggctgccaa cagagtcccg atggcgatgt gatttgccgc tgcaacgaag gctatgccgg
     5941 caagaggtgc gagcactgcg cccagggtta ccagggtaat ccgttggcac cgggaggagt
     6001 ctgtcgcaag atacccgata gttcgtgcaa tgtcgacggc acctacaaca tctacagcaa
     6061 tggaacgtgc cagtgcaagg atagcgtgat tggcgaacag tgcgacacct gcgcgccgaa
     6121 gagtttccac ctcaattcgt tcacctacac cggttgcatc gagtgcttct gcagtggagt
     6181 gggcttggat tgtgacagta gttcgtggta tcgcaaccag gtcaccagca cctttggacg
     6241 aacgcgcgtc aatcatggat tcgccctgat tagcgactat atgcgcaata ccccggtaac
     6301 ggtgcccgtt tccatgtcca cccaggccaa tgccttgagc ttcgtgggat ccgccgagca
     6361 ggccggtaat acgctctact ggagtcttcc cgccgccttc ctgggcaaca agctgacctc
     6421 gtacggaggc aagttgagct acacgctcag ctacagtccc ctgcccagcg gcattatgtc
     6481 gcgcaacagt gcccccgatg tggtgatcaa gagcggcgag gatctgaggc tcatccatta
     6541 caggaagtcg caggtcagtc ccagtgtggc caacacctat gccgtggaga tcaaggagag
     6601 cgcatggcag cgcggcgatg aactggtgcc taaccgtgaa cacgtcctga tggccctcag
     6661 caatattacg gccatctata tcaaggccac gtacacgact agcaccaagg aggcctcgct
     6721 gcgatcggtc acattggata cggccacggc caccaatctg ggcaccgcac gtgccgtcga
     6781 agtggagcag tgccgctgtc ccgagggcta tttgggtctc tcctgcgagc agtgtgctcc
     6841 tggctatacg cgcgatccgg aggcaggaat ctatctgggt ctctgcaggc cctgcgagtg
     6901 caatggacat tccaagtatt gcaacagtga gacaggcgaa tgcgaaagct gttccgacaa
     6961 caccgaagga ttcaattgtg accgatgcgc cgccggctat gtgggtgatg ccacccgagg
     7021 aacttcgtac gactgtcaat acgatgacgg cggctatccg acgtcgcgtc caccggcacc
     7081 gggcaatcag acggccgaat gcctggtgaa ttgccaacag gagggaaccg ccggttgccg
     7141 cggctaccag tgcgagtgca agaggaatgt ggctggcgat cgatgcgatc agtgccgccc
     7201 cggaacctat ggactgtcgg cccaaaatcc ggacggttgc aaggagtgct actgctccgg
     7261 actgaccaac cagtgccgct cggcgtctct ctaccgccag ctgatacccg tggacttcat
     7321 ttcgacgcca ccattgataa cagacgaatt cggcgacatc atggataggg ataaccttgt
     7381 gcccgacgtg cccaggaatg tgtataccta caagcacacc tcctacacgc ccaagtactg
     7441 gagcctgagg ggtagtgtgc tgggcaacca gctgttgtcg tacggcggcc gcttggagta
     7501 cagcctgatt gtggagtccg ttggccggga ccatcgtggc aaggatgtgg tcctaattgg
     7561 caacggactc aagctgatct ggtcgcgacc cgatggccat gacaacgagc aggaatacca
     7621 tgtgcgtttg catgaggacg agcagtggac ggttgaggat cgtggatcgg cacgacaggc
     7681 cacgcgggcc gacttcatga ctgtgctgtc ggatctgcag cacatcctga tcctggccac
     7741 acccaaggtg cccacggtca gcacctcgat tagcaatgtc atcctggaga gttcgataac
     7801 cacgagagcg cctggagcta cgcatgcctc cgatatcgag ttgtgccagt gtccatccgg
     7861 ttatacgggc acttcctgtg agtcctgcgc accactgcac taccgcgacg cctctggacg
     7921 ctgcagtcag tgtccttgcg acgcttccaa cacggaatcc tgcggcttgg tcagcggcgg
     7981 taacgtcgaa tgccagtgca ggccacgctg gaggggtgat cgctgccggg aaattgacac
     8041 atcgcccatt atcgaagaac cgccccagat atgtgattta agcaggggat tctgttgcag
     8101 cggctttcag ttcgatatcg caccgaacga gacaatctcg tttaatgaca ccctgcagat
     8161 atataagggc aacagaatca taggaaatat gaccaagctg cgctacggct gtccatcgcg
     8221 agaaactaac gaaccgactc cggaaccgga taccagtacc gatgatcccg tgcgcaccca
     8281 gatcatagtg tcgattgcca ggccagagat taccattctg cccgtgggtg gatcgctgac
     8341 cctcagctgt accggtcgaa tgcgctggac caatagccca gtgtttgtga actggtacaa
     8401 gcagggcagt cacctgcccg agggagtcga ggtgcaaggc ggtaatctgc agctgttcaa
     8461 cctgcagatc agcgattctg gaatctacat ctgccaggcc gtaagcaacg agaccggcca
     8521 cagctttacg gaccacgtct ccatcaccgt ttcccaggag gaccaacgct cgccggctca
     8581 cattgtggat ttgcccaacg acgtgacctt cgaggagtac gtaagcaatg agatcgtctg
     8641 cgaggtggag ggcaacccac cacccactgt cacctggact cgcgtggatg gccatgcgga
     8701 cgcccaaagt acgcgaacgg acaacaatcg gctggtcttc gattcgccga ggaaatcgga
     8761 cgagggtcgc tatcgctgcc aggcagagaa tagcctgagt cgggaggaga agtacgtagt
     8821 cgtgtatgtc cggagcaatc ctccccagcc gccgccgcag caggatcgtt tgtacatcac
     8881 accgcaggag gtgaacggtg tggccggtga ctccttccag ttgtcctgcc aattcaccag
     8941 cgctgcctct ctgcgctacg attggtccca cgatggtcgc tccctgtccg cgtcgtcacc
     9001 ccgaaatgtt gtggtccgcg gaaatgtcct ggaagtccgc gatgccaacg ttcgcgactc
     9061 cggcacctac acctgtgtgg ccttcgacct gcgcacccga cgcaacttca ccgagagcgc
     9121 acgggtctac atcgagcagc ccaacgagcc gggaatcctt ggcgacaagc cgcatatctt
     9181 gaccttggag cagaacatca taattgtgca aggcgaggac ttgagcatca catgtgaggc
     9241 aagtggaacg ccctatccct cgattaagtg gaccaaggtg caggagaatc tggccgaaaa
     9301 tgtccgcatc agtggcaatg tgctcaccat ctacggaggc cgcagtgaga atcgtggtct
     9361 ttactcctgc atcgccgaga actctcacgg cagcgatcag tccagcacaa gcatcgatat
     9421 tgaaccccgg gagcggccga gtcttacgat tgatacggcc acccaaaagg tttcggttgg
     9481 ctcccaggcg tccctttact gtgccgccca gggcattccc gaaccgaccg tcgagtgggt
     9541 tcgaacggat ggtcagccac tgtcgccgcg tcacaaggtc caggcacccg gctatgttgt
     9601 gatcgatgac attgtgctcg atgatagcgg tacctacgag tgccgggcga gcaacatagc
     9661 tggccaggtg agcggcttgg ccaccattaa cgtccaggag ccaactcttg tgcggatcga
     9721 accagatagg caacaccata tcgtcaccca gggcgacgaa ctctcgctca gctgcgtggg
     9781 cagtggcgtc cctactcctt cggtcttttg gagtttcgag ggaagagacg ttgacaggat
     9841 gggagtaccg gaaggtgctg tttttgcgca acctttccga accaacactg ccgacgtgaa
     9901 aatcttccgg gtgagcaagg agaacgaagg catctacgtc tgtcacggat ccaatgacgc
     9961 gggtgaagat caacaataca ttcgcgtgga ggtacaaccc agacggggtg acgtcggtgc
    10021 aggaggagat gacaatggtg atgtcgatac ccgacagccc cccaatcggc cccaaatcca
    10081 accgaatcca ttgagcaacg aacgcctgac caccgaattg ggcaacaatg tgaccctcat
    10141 ctgcaacgtg gacaacgtga acacggaatg ggaacgcgtc gatggcacac ccctgccgca
    10201 caatgcctac acggtgagaa atacgctggt gattgtcttc gtggagccgc agaatctggg
    10261 tcagtaccgc tgcaatggaa tcggtcgcga tggacgtgtg gaggcccatg tggtgaggga
    10321 gctggttctc ctgcccctgc ccaggatcac cttctatccc aacatcccgc tgaccgtgga
    10381 gctgggccag aacttggatg tctactgcca ggtggagaac gtgcgtccgg aggacgtgca
    10441 ttggaccacc gacaacaatc gaccactgcc cagttccgta cgcatcgagg gcaatgtcct
    10501 caggttcgcg tccatcactc aggctgctgc cggtgaatac cgctgctcgg ccaccaatca
    10561 atatggaagc cgatcgaaga acgccagggt ggtggtgaaa cagcccagtg gcttccagcc
    10621 cgttccccac tcgcaggtgc aacagcgtca ggtgggcgac tccatccagt tgcgatgccg
    10681 cctgaccacc cagtacggcg acgaggttcg cggcaatatc cagttcaact ggtaccgtga
    10741 ggacggcagc cccttgcccc gcggtgtccg tccggatagc caggtgctgc agctggttaa
    10801 attgcagccc gaggacgagg gccgctacat ctgcaactcg tacgatttgg gcagcgggca
    10861 gcaactgccc cccgtctcca tcgacttgca agtactaaga actactaccc agtatccttt
    10921 caatcggttt aagggcggtg tctccctgaa agacacgccc tgcatggttc tgtatatttg
    10981 tgcagcggta ccagcggctc cccagaaccc catctacctg ccgccagtgg cgccaccacg
    11041 ttcgcccgaa aggatcctcg agccccaact gagcctgagt gtacaatcct cgaacctgcc
    11101 agccggcgac ggcaccaccg tcgagtgctt ctcctccgat gactcctacc cagatgtcgt
    11161 gtgggaacgc gccgatggag ctccactcag cgaaaatgtc cagcaagtgg gcaataacct
    11221 ggtgattagt aacgtggcct ccaccgatgc cggtaactat gtgtgcaagt gcaagacgga
    11281 cgagggagat ctgtatacca ccagctacaa actggaggtc gaggagcagc cccatgaact
    11341 gaagagctcc aagatagtct acgccaaggt tggcggaaat gccgacttgc agtgcggagc
    11401 cgatgaagat cgacagccca gctaccgttg gtctcgccaa tacggacaac ttcaggcggg
    11461 acgcagtctg cagaatgaga aactttcgtt ggatcgcgtt caggccaacg atgccggaac
    11521 ttatgtttgt tcggcccaat acagcgatgg cgagacggtt gacttcccca acattctggt
    11581 tgtgaccggg gcgattcccc agttccgcca ggagccccgc agctacatga gcttccccac
    11641 gctctcgaac tcctcgttca agttcaactt cgagctgacc ttccggccgg aaaacgccga
    11701 cggactgctg ctcttcaatg gacagacccg cggaagcggt gactatatcg cactctcgct
    11761 gaaggatcgc tatgcggagt tccggttcga ttttggcggt aaaccgttgc tggtgcgagc
    11821 ggaggagcca ctggctttgg atgaatggca cacggtgcgc gtgagtcgct tcaagcggga
    11881 tggctacatc caggtggacg accagcatcc ggtggccttc cccacctccc agcatcagca
    11941 gataccccag ttggaactga ttgaggatct gtacattggc ggcgtgccca actgggagtt
    12001 cctgcccgcc gaggcggtgg gtcagcaatc aggcttcgtg ggctgcatta gccggctgac
    12061 cctgcaggga cgcaccgtgg agctgatccg ggaggccaag ttcaaggagg gcatcaccga
    12121 ttgccggccc tgcgcccagg gaccctgcca gaacaagggc gtctgcctgg agagccagac
    12181 ggagcaggcc tacacctgcg tctgccagcc gggctggact ggccgggatt gtgccatcga
    12241 gggcacccag tgcaccgcag gagtttgcgg ctcgggacgc tgcgagaata cggagaacga
    12301 catggagtgc ctgtgcccgc tgaacagggc aggcgatcga tgccagtaca atgagattct
    12361 aaatgaacag agcttgaatt tcaagagcaa cagctttgcg gcctacggaa ctcccaaggt
    12421 caccaaagta aacatcacac tctccgttcg tcccgcgagc ctggaggact ctgtgatcct
    12481 gtacacggcg gaatccactc tgcccagcgg cgattacctg gctttggtcc ttcgcggtgg
    12541 ccacgcggag ctgctgatca acacggccgc ccgcttggat cccgtggtgg tgcgttcggc
    12601 ggaaccgctg cccctcaatc gctggaccag aatcgagatc aggcgtcgcc tgggcgaggg
    12661 aatcctcaag gtgggcgatg gacccgagcg aaaggccaag gcaccgggat ccgatcgcat
    12721 tctgtcgctc aagacccacc tctttgtggg cggcgtcgat cggtcgaccg taaagatcaa
    12781 ccgtgatgtg aacatcacca agggcttcga tggctgcatc tcgaagctgt acaactcgca
    12841 gaaatccgtc aatctgctgg gtgacatcag ggatgcggcg aatgtccaga actgtgggga
    12901 ggcgaatgag atagatgacg atgagtatga gatgccagta gcgctgccat cgcctaaggt
    12961 cgccgagaat gaacgtcagc tgatggcgcc gtgtgccagt gatccctgcg agaacggggg
    13021 aagctgcagc gagcaggagg acatggccat ctgctcctgt cccttcggct tcagcggcaa
    13081 acactgccag aatcacctcc agctgagctt caatgcctcg ttccgcggcg atggctacgt
    13141 ggagctgaac cgcagccact tccaacccgc cctggagcag acgtactccc acattggcat
    13201 tgtgttcacc accaacaagc cgaatggcct gcttttctgg tggggccagg aggccgggga
    13261 ggagtacacc ggacaggact tcattgccgc cgccgtggtc gatggctatg tggagtactc
    13321 gatgaggctc gatggcgagg aggcggtcat tcggaacagc gatatccgcg tggacaatgg
    13381 cgagcggcac attgtgatcg ccaagcggga tgagaacacc gccatgctgg aactcgatca
    13441 gatcctggac acgggcgata cgcgacccac catcaacaag gcaatgaagc tgccgggcaa
    13501 tgtgtttgtc ggtggcgctc ctgatgtcgc ggcattcacg ggcttccgct acaaggacaa
    13561 tttcaacggc tgcattgtgg tcgtcgaggg cgaaaccgtg ggccaaatta accttagttc
    13621 agctgccatc aatggagtga atgccaacgt gtgtcccgct aacgacgaac ctctgggagg
    13681 aaccgaaccg ccagtcgtct gaggacacaa ccagcaaccg aaattagctt tttaattaaa
    13741 cattaacaaa tgaaacaaaa agaaaaacaa tttttatata tacaacatat gaataagccc
    13801 caagcaaacc tacaaaaaat tgaatattat acgacgaaca gataatataa aaacaaaaaa
    13861 agagagaaac gatcacttct actacaattg cttcttcgat ccttaagtct aggttaaaga
    13921 ttgtagcaag aaaacaagcg aatatcacaa acatttattt aacaagaacg ccatgcgaga
    13981 agtgaaacga aacagaaaca ataatgcaat taatgcagat aatacagata aagcctagaa
    14041 ccctaagaac taactaacta actcgaacaa gaacaacaac gcatactagc caactgcaac
    14101 cacaacaacc acaatagtga aggcatttta attataattt tagtctctag cttataacta
    14161 tgactacgac tcgttttttt tgtgagccca gtgtaaaatg ttggaaatcg gaaattggcc
    14221 ctacacacaa acacacacaa gttattaatt aaataccaat tgataccata taatgataaa
    14281 tgaaatacta tgaatgcaac tattgtgaac gaacgaaaac cgttgagtgg ataaaaagca
    14341 taagcagaag atatattaaa atgaaatcaa caaca