PREDICTED: Drosophila takahashii Sepiapterin reductase (Sptr),

LOCUS       XM_044395065             976 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_044395065
VERSION     XM_044395065.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044395065.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..976
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..976
                     /gene="Sptr"
                     /note="Sepiapterin reductase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:123003225"
     CDS             116..901
                     /gene="Sptr"
                     /codon_start=1
                     /product="sepiapterin reductase"
                     /protein_id="XP_044251000.1"
                     /db_xref="GeneID:123003225"
                     /translation="MDLKQRTYLLVTGASRGIGREFAQQLAKRIAAEGSVVVLLGRNQ
                     PLLEEARAQIVASVPELPVHTYSLELESAKTEDFAQILESSAAQKSFQRAIVIHNAGT
                     VGDTSKRAKEIGDTSFLQSYYHTNVFSAISLNCEFMRVFRGIPKLVVNLSTLAAIAPI
                     SSMAHYCTVKAAREMYFRVLATEESAEETLVLNYAPGVIDTQMTVQVQREAHDPAVVA
                     MFREQREAKTMLTTAQTTERFIQILEARKFKSGDHVDYRDGQT"
     misc_feature    134..889
                     /gene="Sptr"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(152..169,236..244,317..325,410..418,488..490,
                     566..574,611..613,623..625,701..712,716..727)
                     /gene="Sptr"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187625"
     misc_feature    order(350..352,461..466,470..475,482..487,494..499,
                     506..511,518..520,578..586,605..610,614..619,629..631,
                     638..643,650..655,659..667)
                     /gene="Sptr"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187625"
     misc_feature    order(491..493,572..574,611..613,623..625)
                     /gene="Sptr"
                     /note="active site"
                     /db_xref="CDD:187625"
     polyA_site      976
                     /gene="Sptr"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaaagctgcc aaatcagcca aaagccaaag cgagttaaaa gaagaaaagg cagccaactg
       61 ttgccgccgg tttgtggaaa atagaaagta atttagtctg gtttttcctg caactatgga
      121 cctgaaacag cgcacttacc tcctggtgac cggggcctct cgtggaattg gccgggagtt
      181 tgcccagcag ctggccaagc ggatagcggc cgagggatcc gtggtcgtcc tcctgggacg
      241 caatcagccg cttctggagg aggccagggc acagatcgtg gcctcggtgc cggaactacc
      301 cgtacacacg tactccctgg agctggaatc ggccaaaacg gaggactttg cccagattct
      361 ggagagttcc gccgcccaga agtcgttcca gcgagccata gtcatccaca atgccggcac
      421 cgtgggcgat acctccaaga gggccaagga aatcggggat accagcttcc tgcagagcta
      481 ctaccacacc aatgtcttct cggccatatc cctgaactgc gagttcatgc gagtcttccg
      541 gggcatcccc aaattggtgg tcaacctgag caccttggcc gccattgccc cgatctcatc
      601 gatggcccac tactgcacgg tgaaggcggc ccgcgagatg tacttccgtg tgctggccac
      661 cgaggagtcc gccgaggaga ccctggtgct gaactacgcg cccggcgtca tagacaccca
      721 gatgaccgtc caggtgcagc gggaggccca cgatcccgcc gtcgttgcca tgttccggga
      781 gcagcgggag gccaagacca tgctgaccac cgcccagacc acggagcgct tcatccagat
      841 cctcgaggcc cgcaagttca agtccggcga tcatgtggac tacagggatg gacagactta
      901 ggttcattat gtattgtgtg atgtttggta atgggttctt gtattaaaac attaaaaaga
      961 taacaacttt gaaaaa