Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 putative GTPase (NOG2), partial mRNA.


LOCUS       XM_019475468            1602 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_019475468
VERSION     XM_019475468.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1602)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1602)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1602)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1602)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1602)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1602)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1602
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1602
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /db_xref="GeneID:3640299"
     CDS             1..1602
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="Putative nucleolar GTPase; repressed by
                     prostaglandins; Hap43-induced, rat catheter and Spider
                     biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="putative GTPase"
                     /protein_id="XP_019331013.1"
                     /db_xref="CGD:CAL0000182741"
                     /db_xref="GeneID:3640299"
                     /translation="MGTQKKEKQRRVRENDTRDGNLRVKGENFYRDAKKVKHLNMYKQ
                     GRAIRNKKGEIIKAADLQSTDIPNARVDPNRKWFGNTRVIAQDALTHFREVMGEKSKD
                     SYQVLLKRNKLPMSLLDEKDTTESPTAKIVETESYSSTFGPKQQRKKPRVAASSLEDL
                     MNAAEADSTQFQEKQELDSTLGLMGGSILDKDDFTQEAKEAIFHKGQSKRIWNELYKV
                     IDSSDVVIHVLDARDPVGTRCESVEKYIKDECPHKHLIYVLNKCDLVPTWVAAAWVKH
                     LSKSFPTLAFHASITNSFGKGSLIQLLRQFSTLHSDRKQISVGFIGYPNTGKSSIINT
                     LRKKKVCQVAPIPGETKVWQYITLMKRIFLIDCPGIVPPSSKDTESDILFRGVVRVEH
                     VSNPEQYIPDMLQKCERKHLERTYEIKGWSKFEEDESLLERASTEFIELIARKQGRLL
                     KGGEPDESGVSKQILNDFNRGKIPWFVPPPKDEEKDEDKTGEDKKIGYKRKRQEREAA
                     EKELQEKEENQDEDDKEVKKAKLEE"
     misc_feature    121..513
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="NGP1NT (NUC091) domain; Region: NGP1NT; pfam08153"
                     /db_xref="CDD:462379"
     misc_feature    640..1110
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="A novel nucleolar GTP-binding protein, circularly
                     permuted subfamily of the Ras GTPases; Region: NGP_1;
                     cd01858"
                     /db_xref="CDD:206751"
     misc_feature    order(778..783,787..792,865..873,970..990,1105..1107)
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206751"
     misc_feature    778..789
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="G4 box; other site"
                     /db_xref="CDD:206751"
     misc_feature    865..873
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="G5 box; other site"
                     /db_xref="CDD:206751"
     misc_feature    955..>1293
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    964..987
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="G1 box; other site"
                     /db_xref="CDD:206751"
     misc_feature    964..987
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="G1 box; other site"
                     /db_xref="CDD:206668"
     misc_feature    1039..1062
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206751"
     misc_feature    1048..1050
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="G2 box; other site"
                     /db_xref="CDD:206751"
     misc_feature    1048..1050
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="G2 box; other site"
                     /db_xref="CDD:206668"
     misc_feature    1096..1107
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="G3 box; other site"
                     /db_xref="CDD:206751"
     misc_feature    1096..1107
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="G3 box; other site"
                     /db_xref="CDD:206668"
     misc_feature    order(1102..1107,1183..1188)
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206668"
     misc_feature    1102..1110
                     /gene="NOG2"
                     /locus_tag="CAALFM_C603640WA"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206751"
ORIGIN      
        1 atgggaactc aaaagaagga aaagcaaaga agggtaaggg agaatgatac cagagacggt
       61 aatcttcgag ttaaaggaga aaacttttac cgtgatgcta aaaaagtgaa acatttgaat
      121 atgtataaac aaggaagagc tattcgtaat aagaagggag aaataataaa agctgctgat
      181 ttacaaagta cagatatacc aaatgcaaga gttgatccaa atagaaaatg gttcggtaac
      241 acaagagtga ttgctcaaga tgctttaacc catttcagag aagttatggg tgaaaaatcc
      301 aaagattcat atcaagtatt attgaaaaga aataaattac caatgtcatt attggatgaa
      361 aaagatacaa ctgaatcacc aactgctaaa attgttgaaa ccgaatcgta ttcctcgaca
      421 tttggtccta aacaacaacg taagaaacct agagtcgctg cttctagttt ggaagattta
      481 atgaatgctg ctgaagctga ttcaacccaa ttccaagaaa agcaagaatt agattcaact
      541 cttggattaa tgggtggttc tatcttggat aaagatgatt tcacacaaga agctaaagag
      601 gctattttcc ataaaggtca atccaaacgt atttggaatg agttatataa agttattgac
      661 tcttctgatg tggttataca tgtgttggat gccagagatc cagttggtac cagatgtgaa
      721 tctgttgaga aatacataaa ggatgaatgt cctcataaac atttaattta tgttttaaac
      781 aaatgtgatt tagttccaac ttgggtagcg gctgcttggg ttaaacattt atcaaaatca
      841 ttcccaacat tagcatttca tgcttctata accaactcgt ttggtaaggg ttctttgatt
      901 caattattaa gacaattttc aactttacat tcagacagaa aacaaatttc tgtggggttc
      961 ataggatacc caaacactgg taaatcaagt ataataaaca ctttgcgtaa gaaaaaagtt
     1021 tgtcaagttg ctcctatacc cggtgaaacc aaagtttggc aatatattac tttgatgaaa
     1081 cgtatattct tgattgattg tcctgggatt gttccacccc tgagcaaaga taccgaatct
     1141 gacattttat tcagaggtgt ggtgagagtg gaacatgttt ctaatccaga acaatacatc
     1201 cctgacatgt tgcaaaaatg tgaaagaaaa catcttgaga gaacctatga aatcaaaggt
     1261 tggagtaaat ttgaggaaga tgaaagtcta ttggaaagag ctagtacaga atttatagaa
     1321 ttaattgcta ggaaacaagg tagattgttg aaaggtggtg aaccagatga aagtggtgtt
     1381 tctaaacaaa tattaaatga tttcaaccgt ggtaaaatcc cttggttcgt acctccacca
     1441 aaggatgagg aaaaagatga agacaaaact ggtgaagata agaaaattgg ctacaagaga
     1501 aagagacaag aaagagaagc tgctgagaaa gagctacaag agaaagaaga aaatcaagat
     1561 gaagatgata aagaagttaa gaaagctaaa ttagaagagt aa