Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Fpg1p (FPG1), partial mRNA.


LOCUS       XM_019475458            1119 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_019475458
VERSION     XM_019475458.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1119)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1119)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1119)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1119)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1119)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1119)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1119
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1119
                     /gene="FPG1"
                     /locus_tag="CAALFM_C601820CA"
                     /db_xref="GeneID:3641632"
     CDS             1..1119
                     /gene="FPG1"
                     /locus_tag="CAALFM_C601820CA"
                     /note="Formamidopyrimidine DNA glycosylase, involved in
                     repair of gamma-irradiated DNA; Hap43p-repressed gene"
                     /codon_start=1
                     /transl_table=12
                     /product="Fpg1p"
                     /protein_id="XP_019331003.1"
                     /db_xref="CGD:CAL0000181241"
                     /db_xref="GeneID:3641632"
                     /translation="MPEVAEVSHVCALLKRNILGFRITKVNLLHDPLLFPVLKNTNDA
                     EKELNKMRKVLTNAVVTSVGRHGKYFWIRLNNHNTTNVLLMHFGMTGMIKLRNVHSHL
                     AFMENGGDKKALEKLERFRYKDSRIKPDVEVKQEWPPRFTKFNMELENNDKKLEFAFS
                     DPRRLARVRLLSGLEVSTDESLLKLSPLNALGPDYSKPEVPPKESEPFVFGDPDSDNH
                     GRARLSIDEFSALILSKKKPIKSLLLDQTYFAGVGNWVADEVLFQAHIHPNEILSSKI
                     SKDLEYVHPVIQQLYDSLIYVCEEAVRVEGDVAKFPDDWLMLHRWGKGRKEKRKTPNG
                     YILDHITVGGRTSCYCPELQRLIKVETATTTKRRKVKR"
     misc_feature    1..513
                     /gene="FPG1"
                     /locus_tag="CAALFM_C601820CA"
                     /note="N-terminal domain of the plant and fungal Nei and
                     related proteins; Region: PF_Nei_N; cd08972"
                     /db_xref="CDD:176806"
     misc_feature    4..1065
                     /gene="FPG1"
                     /locus_tag="CAALFM_C601820CA"
                     /note="Formamidopyrimidine-DNA glycosylase [Replication,
                     recombination and repair]; Region: Nei; COG0266"
                     /db_xref="CDD:440036"
     misc_feature    order(4..9,202..204,256..258,262..270,418..423)
                     /gene="FPG1"
                     /locus_tag="CAALFM_C601820CA"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:176806"
     misc_feature    4..6
                     /gene="FPG1"
                     /locus_tag="CAALFM_C601820CA"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:176806"
     misc_feature    order(7..18,22..27,34..36,193..207)
                     /gene="FPG1"
                     /locus_tag="CAALFM_C601820CA"
                     /note="putative H2TH interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:176806"
     misc_feature    order(7..9,202..204)
                     /gene="FPG1"
                     /locus_tag="CAALFM_C601820CA"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:176806"
ORIGIN      
        1 atgccagagg ttgcagaagt ttcacatgtg tgtgcgttgt taaaacgaaa cattttgggc
       61 tttcgaatca cgaaagtgaa tttgttacat gatccattgc tattccctgt gcttaaaaat
      121 acgaatgatg ctgaaaaaga attgaataag atgagaaaag tcttaacaaa tgcagttgtt
      181 acttcagtgg gtcgtcatgg caagtatttt tggattagac taaacaacca caatacaact
      241 aacgtcttgc ttatgcattt cggaatgact ggaatgatca agttacgaaa tgttcactcg
      301 catttagcat ttatggaaaa tggcggtgat aaaaaggctt tggagaagct agagaggttt
      361 agatataaag acagtagaat taaaccagac gtcgaagtca agcaagagtg gcccccaagg
      421 tttacaaagt ttaatatgga attggaaaac aatgacaaaa aactagagtt tgcattttcc
      481 gatccaagaa gattagccag ggttcgacta ctctctggtt tggaagtaag cactgacgag
      541 agtttgttga aattgagtcc tttgaatgcc ctaggtcccg attacagtaa gcctgaagta
      601 ccgccaaaag aactggaacc ctttgtattt ggagatcctg attcagataa ccatggtcgt
      661 gccagattgt ctattgatga gtttagtgct cttatcttgt cgaaaaagaa accaataaag
      721 agtctccttt tggatcagac ctactttgct ggggttggaa attgggtggc tgatgaagtt
      781 ttatttcaag ctcacattca tccaaatgaa atactttcaa gtaaaatctc taaagatttg
      841 gagtatgtgc atcctgttat acagcagttg tatgattcat taatctatgt gtgtgaggaa
      901 gctgttcgag ttgaaggtga tgtggcaaag tttccggacg actggttaat gttgcatcga
      961 tggggaaaag gtagaaaaga aaaaagaaaa acaccaaatg ggtatatttt agaccacatt
     1021 acagttgggg ggagaacaag ttgttattgt ccagagttac agaggctaat aaaagtagag
     1081 acagcaacaa caactaaacg aagaaaagtc aaaagatag