Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_019475458 1119 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_019475458 VERSION XM_019475458.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1119) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1119) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1119) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1119) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1119) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1119) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1119 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1119 /gene="FPG1" /locus_tag="CAALFM_C601820CA" /db_xref="GeneID:3641632" CDS 1..1119 /gene="FPG1" /locus_tag="CAALFM_C601820CA" /note="Formamidopyrimidine DNA glycosylase, involved in repair of gamma-irradiated DNA; Hap43p-repressed gene" /codon_start=1 /transl_table=12 /product="Fpg1p" /protein_id="XP_019331003.1" /db_xref="CGD:CAL0000181241" /db_xref="GeneID:3641632" /translation="MPEVAEVSHVCALLKRNILGFRITKVNLLHDPLLFPVLKNTNDA EKELNKMRKVLTNAVVTSVGRHGKYFWIRLNNHNTTNVLLMHFGMTGMIKLRNVHSHL AFMENGGDKKALEKLERFRYKDSRIKPDVEVKQEWPPRFTKFNMELENNDKKLEFAFS DPRRLARVRLLSGLEVSTDESLLKLSPLNALGPDYSKPEVPPKESEPFVFGDPDSDNH GRARLSIDEFSALILSKKKPIKSLLLDQTYFAGVGNWVADEVLFQAHIHPNEILSSKI SKDLEYVHPVIQQLYDSLIYVCEEAVRVEGDVAKFPDDWLMLHRWGKGRKEKRKTPNG YILDHITVGGRTSCYCPELQRLIKVETATTTKRRKVKR" misc_feature 1..513 /gene="FPG1" /locus_tag="CAALFM_C601820CA" /note="N-terminal domain of the plant and fungal Nei and related proteins; Region: PF_Nei_N; cd08972" /db_xref="CDD:176806" misc_feature 4..1065 /gene="FPG1" /locus_tag="CAALFM_C601820CA" /note="Formamidopyrimidine-DNA glycosylase [Replication, recombination and repair]; Region: Nei; COG0266" /db_xref="CDD:440036" misc_feature order(4..9,202..204,256..258,262..270,418..423) /gene="FPG1" /locus_tag="CAALFM_C601820CA" /note="putative DNA binding site [nucleotide binding]; other site" /db_xref="CDD:176806" misc_feature 4..6 /gene="FPG1" /locus_tag="CAALFM_C601820CA" /note="catalytic residue [active]" /db_xref="CDD:176806" misc_feature order(7..18,22..27,34..36,193..207) /gene="FPG1" /locus_tag="CAALFM_C601820CA" /note="putative H2TH interface [polypeptide binding]; other site" /db_xref="CDD:176806" misc_feature order(7..9,202..204) /gene="FPG1" /locus_tag="CAALFM_C601820CA" /note="putative catalytic residues [active]" /db_xref="CDD:176806" ORIGIN 1 atgccagagg ttgcagaagt ttcacatgtg tgtgcgttgt taaaacgaaa cattttgggc 61 tttcgaatca cgaaagtgaa tttgttacat gatccattgc tattccctgt gcttaaaaat 121 acgaatgatg ctgaaaaaga attgaataag atgagaaaag tcttaacaaa tgcagttgtt 181 acttcagtgg gtcgtcatgg caagtatttt tggattagac taaacaacca caatacaact 241 aacgtcttgc ttatgcattt cggaatgact ggaatgatca agttacgaaa tgttcactcg 301 catttagcat ttatggaaaa tggcggtgat aaaaaggctt tggagaagct agagaggttt 361 agatataaag acagtagaat taaaccagac gtcgaagtca agcaagagtg gcccccaagg 421 tttacaaagt ttaatatgga attggaaaac aatgacaaaa aactagagtt tgcattttcc 481 gatccaagaa gattagccag ggttcgacta ctctctggtt tggaagtaag cactgacgag 541 agtttgttga aattgagtcc tttgaatgcc ctaggtcccg attacagtaa gcctgaagta 601 ccgccaaaag aactggaacc ctttgtattt ggagatcctg attcagataa ccatggtcgt 661 gccagattgt ctattgatga gtttagtgct cttatcttgt cgaaaaagaa accaataaag 721 agtctccttt tggatcagac ctactttgct ggggttggaa attgggtggc tgatgaagtt 781 ttatttcaag ctcacattca tccaaatgaa atactttcaa gtaaaatctc taaagatttg 841 gagtatgtgc atcctgttat acagcagttg tatgattcat taatctatgt gtgtgaggaa 901 gctgttcgag ttgaaggtga tgtggcaaag tttccggacg actggttaat gttgcatcga 961 tggggaaaag gtagaaaaga aaaaagaaaa acaccaaatg ggtatatttt agaccacatt 1021 acagttgggg ggagaacaag ttgttattgt ccagagttac agaggctaat aaaagtagag 1081 acagcaacaa caactaaacg aagaaaagtc aaaagatag