Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_019475457 1533 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_019475457 VERSION XM_019475457.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1533) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1533) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1533) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1533) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1533) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1533) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1533 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1533 /gene="ZCF18" /locus_tag="CAALFM_C601790CA" /db_xref="GeneID:3641635" CDS 1..1533 /gene="ZCF18" /locus_tag="CAALFM_C601790CA" /note="Putative Zn(II)2Cys6 transcription factor; heterozygous null mutant displays sensitivity to virgineone and decreased colonization of mouse kidneys" /codon_start=1 /transl_table=12 /product="Zcf18p" /protein_id="XP_019331002.1" /db_xref="CGD:CAL0000179911" /db_xref="GeneID:3641635" /translation="MSVPLTKEKKKRSRGGCVSCKKLKIKCNEQKPICEYCRYTKRTC IYPILAPIKGYRRKTSRSPQESKDEKTSTPHSSTTAISPISSSSTSDKLNNLYVSNNE VPDINPYHYDKLSRDLVLTNSTSMLGITRFELRLLQFFDQECINFFSFGVNKNIHNTW KYKVPYLFLESELVRKSMFALSAMGLSTTLDLDELQSIDADEDEKSLVNIYNTNVDEL DNIFENTTKYFMDTISKTKHMIGSIEDDSNIASFDDPKSAKELLVSSILVFSYLGVHP HRLSPLIDFTQERGDLIQISKGIRYTIMSCAPTILKSDMSPLLFFHGIEKMQTPTFEK CQYPIIQDLKNDIDEFGSGEGSSEISEELSILKDVVARLMMCINGCKFFKFPIPLFRF LMLFDDHFRDLLYNKHRLALRILYVYSALCSICRFQFFDERNVWKDYMTWYRGYAAEN FDGYKNETDEYLYFLAAIEHFHWDDFTNFDKFNPKAEFEKVIQSGKYRKQSLLVGQNS NC" misc_feature 34..141 /gene="ZCF18" /locus_tag="CAALFM_C601790CA" /note="GAL4-like Zn2Cys6 binuclear cluster DNA-binding domain; found in transcription regulators like GAL4. Domain consists of two helices organized around a Zn(2)Cys(6)motif; Binds to sequences containing 2 DNA half sites comprised of 3-5 C/G combinations; Region: GAL4; cd00067" /db_xref="CDD:238023" misc_feature order(34..36,46..48,61..72,76..78,85..87,115..117) /gene="ZCF18" /locus_tag="CAALFM_C601790CA" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238023" misc_feature order(49..51,58..60,79..81,100..102,109..111,130..132) /gene="ZCF18" /locus_tag="CAALFM_C601790CA" /note="Zn2+ binding site [ion binding]; other site" /db_xref="CDD:238023" ORIGIN 1 atgtcagtac cactcaccaa agaaaagaaa aagagatcaa gaggaggttg tgttagttgt 61 aaaaagctta aaataaagtg taacgaacaa aagcctattt gtgaatactg tcgatatacc 121 aaaagaacat gtatttatcc catcttggca cccataaaag gctacagaag aaagacaagc 181 agatcaccac aagagagtaa agacgagaaa acatcaacac ctcattcatc cacaactgca 241 atctctccaa tatcatcatc gtcaacttct gataaactca acaatttata tgtttcaaac 301 aacgaggtac cagacataaa tccctaccat tacgataaat tatcgcgtga cttggtattg 361 accaattcaa ccagtatgct aggtataact agatttgaat tgcgtctact acagtttttt 421 gatcaagagt gtatcaattt tttttcattc ggggtaaaca agaacataca caacacttgg 481 aagtacaaag tgccctatct ctttttagaa agtgagttgg tgaggaaaag tatgtttgca 541 ttatcagcaa tgggcttgct gacaacgttg gatttggacg aactacaaag tattgacgca 601 gatgaggatg aaaagtcgtt agtcaacatt tacaatacca acgtggacga attggacaat 661 atttttgaaa atactacaaa atattttatg gacacaataa gcaagaccaa acacatgata 721 ggttcaatag aagatgattc taatattgcc agttttgacg atccaaaatc tgctaaggaa 781 ttacttgtgt caagcattct agtattctcg tatttgggag tgcatccaca tagattgctg 841 ccattgattg attttacaca ggaacgagga gacctaattc agataagtaa gggcattcga 901 tacactataa tgagttgtgc tcccactatt ttgaaatctg atatgagccc tcttttgttc 961 ttccatggaa ttgaaaaaat gcaaacgcca acatttgaga aatgccaata tcccataatt 1021 caagatttga aaaatgatat tgacgaattt ggttctggcg aagggagttc agagatttca 1081 gaagaactat caatactcaa agatgtagta gcaagattaa tgatgtgcat aaatggatgt 1141 aaatttttca aattccccat accactattt cgtttcttga tgttatttga tgatcatttt 1201 cgagatttgt tatacaacaa gcatagactc gctttacgaa ttttatatgt ctattccgct 1261 ttgtgttcaa tatgtcgatt tcaatttttt gatgaacgta atgtatggaa agattatatg 1321 acttggtaca ggggttatgc tgctgaaaat tttgatggct acaaaaatga aacggatgaa 1381 tatttgtatt ttttggcagc aattgagcat tttcactggg acgattttac gaactttgat 1441 aagtttaatc ctaaagcaga atttgaaaag gttatacaga gtggtaaata cagaaaacaa 1501 ctgctacttg ttggtcagaa cctgaactgc tga