Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Zcf18p (ZCF18), partial mRNA.


LOCUS       XM_019475457            1533 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_019475457
VERSION     XM_019475457.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1533)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1533)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1533)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1533)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1533)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1533)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1533
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1533
                     /gene="ZCF18"
                     /locus_tag="CAALFM_C601790CA"
                     /db_xref="GeneID:3641635"
     CDS             1..1533
                     /gene="ZCF18"
                     /locus_tag="CAALFM_C601790CA"
                     /note="Putative Zn(II)2Cys6 transcription factor;
                     heterozygous null mutant displays sensitivity to
                     virgineone and decreased colonization of mouse kidneys"
                     /codon_start=1
                     /transl_table=12
                     /product="Zcf18p"
                     /protein_id="XP_019331002.1"
                     /db_xref="CGD:CAL0000179911"
                     /db_xref="GeneID:3641635"
                     /translation="MSVPLTKEKKKRSRGGCVSCKKLKIKCNEQKPICEYCRYTKRTC
                     IYPILAPIKGYRRKTSRSPQESKDEKTSTPHSSTTAISPISSSSTSDKLNNLYVSNNE
                     VPDINPYHYDKLSRDLVLTNSTSMLGITRFELRLLQFFDQECINFFSFGVNKNIHNTW
                     KYKVPYLFLESELVRKSMFALSAMGLSTTLDLDELQSIDADEDEKSLVNIYNTNVDEL
                     DNIFENTTKYFMDTISKTKHMIGSIEDDSNIASFDDPKSAKELLVSSILVFSYLGVHP
                     HRLSPLIDFTQERGDLIQISKGIRYTIMSCAPTILKSDMSPLLFFHGIEKMQTPTFEK
                     CQYPIIQDLKNDIDEFGSGEGSSEISEELSILKDVVARLMMCINGCKFFKFPIPLFRF
                     LMLFDDHFRDLLYNKHRLALRILYVYSALCSICRFQFFDERNVWKDYMTWYRGYAAEN
                     FDGYKNETDEYLYFLAAIEHFHWDDFTNFDKFNPKAEFEKVIQSGKYRKQSLLVGQNS
                     NC"
     misc_feature    34..141
                     /gene="ZCF18"
                     /locus_tag="CAALFM_C601790CA"
                     /note="GAL4-like Zn2Cys6 binuclear cluster DNA-binding
                     domain; found in transcription regulators like GAL4.
                     Domain consists of two helices organized around a
                     Zn(2)Cys(6)motif; Binds to sequences containing 2 DNA half
                     sites comprised of 3-5 C/G combinations; Region: GAL4;
                     cd00067"
                     /db_xref="CDD:238023"
     misc_feature    order(34..36,46..48,61..72,76..78,85..87,115..117)
                     /gene="ZCF18"
                     /locus_tag="CAALFM_C601790CA"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238023"
     misc_feature    order(49..51,58..60,79..81,100..102,109..111,130..132)
                     /gene="ZCF18"
                     /locus_tag="CAALFM_C601790CA"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238023"
ORIGIN      
        1 atgtcagtac cactcaccaa agaaaagaaa aagagatcaa gaggaggttg tgttagttgt
       61 aaaaagctta aaataaagtg taacgaacaa aagcctattt gtgaatactg tcgatatacc
      121 aaaagaacat gtatttatcc catcttggca cccataaaag gctacagaag aaagacaagc
      181 agatcaccac aagagagtaa agacgagaaa acatcaacac ctcattcatc cacaactgca
      241 atctctccaa tatcatcatc gtcaacttct gataaactca acaatttata tgtttcaaac
      301 aacgaggtac cagacataaa tccctaccat tacgataaat tatcgcgtga cttggtattg
      361 accaattcaa ccagtatgct aggtataact agatttgaat tgcgtctact acagtttttt
      421 gatcaagagt gtatcaattt tttttcattc ggggtaaaca agaacataca caacacttgg
      481 aagtacaaag tgccctatct ctttttagaa agtgagttgg tgaggaaaag tatgtttgca
      541 ttatcagcaa tgggcttgct gacaacgttg gatttggacg aactacaaag tattgacgca
      601 gatgaggatg aaaagtcgtt agtcaacatt tacaatacca acgtggacga attggacaat
      661 atttttgaaa atactacaaa atattttatg gacacaataa gcaagaccaa acacatgata
      721 ggttcaatag aagatgattc taatattgcc agttttgacg atccaaaatc tgctaaggaa
      781 ttacttgtgt caagcattct agtattctcg tatttgggag tgcatccaca tagattgctg
      841 ccattgattg attttacaca ggaacgagga gacctaattc agataagtaa gggcattcga
      901 tacactataa tgagttgtgc tcccactatt ttgaaatctg atatgagccc tcttttgttc
      961 ttccatggaa ttgaaaaaat gcaaacgcca acatttgaga aatgccaata tcccataatt
     1021 caagatttga aaaatgatat tgacgaattt ggttctggcg aagggagttc agagatttca
     1081 gaagaactat caatactcaa agatgtagta gcaagattaa tgatgtgcat aaatggatgt
     1141 aaatttttca aattccccat accactattt cgtttcttga tgttatttga tgatcatttt
     1201 cgagatttgt tatacaacaa gcatagactc gctttacgaa ttttatatgt ctattccgct
     1261 ttgtgttcaa tatgtcgatt tcaatttttt gatgaacgta atgtatggaa agattatatg
     1321 acttggtaca ggggttatgc tgctgaaaat tttgatggct acaaaaatga aacggatgaa
     1381 tatttgtatt ttttggcagc aattgagcat tttcactggg acgattttac gaactttgat
     1441 aagtttaatc ctaaagcaga atttgaaaag gttatacaga gtggtaaata cagaaaacaa
     1501 ctgctacttg ttggtcagaa cctgaactgc tga