Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Cubilin (Cubn), mRNA.


LOCUS       XM_017157408           11532 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017157408
VERSION     XM_017157408.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157408.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..11532
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..11532
                     /gene="Cubn"
                     /note="Cubilin; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108068043"
     CDS             87..11399
                     /gene="Cubn"
                     /codon_start=1
                     /product="cubilin homolog"
                     /protein_id="XP_017012897.2"
                     /db_xref="GeneID:108068043"
                     /translation="MKGSARSRLLLCLAIFIITDIWPFAEGFVNSPKIISKDGNLIFE
                     SGANRNISFRLSGNSRLTINEEFDVMELLMATGGGKKRPNGPKDEWNTGEDFVDVREL
                     ADQMADFKRRVFGVNGLDATLRLQTNRTRGSLALMRRFQTRLRAVENKVDRMKTQLET
                     NSCASGPCENGGTCYNTFNGFRCQCRAAFEGTKCEVDVNECALYEGTDLGCQNGGQCQ
                     NQFGSYSCLCQPGWHGMHCSQRKADCSQSSAWELCGHGSCIPSADSAGYRCLCEPGWK
                     SNGVTPVCGEDVDECSDSAAYRPCSTKCINLPGSFTCAPCAAGLTGNGISCRDLDECQ
                     TNNGGCSLSPKVDCINTYGSYHCGECPLGWTGDGRKCERSAEDFDIQTGQRPRSCPAS
                     NNPCYPTASCFLISGTATCRCPVGMVGSGYGPSGCVNGTTTNCAGNPCLNDGICLDAG
                     PSNFTCLCPSGFKQPICEPMASPCDLHPCKNGGRCRPTVGATGDGFVCQCMPGYRGRL
                     CDTRFSSCNGMLAAPSGRLKYPPEGTGYEHNAQCAWVIRTNESLVVNVTFNSFDVEDS
                     TECRFDWLQINDGRSAAAQIIGRYCGNHLPHGGNIVSSGNQLYLWFRSDNSTAREGFD
                     LSWNSMQPQCGGRLEFETHGTLASPGSPGNYPKNRDCRWQLVAPTNKRIKLTFFSLQL
                     EQHDSCNFDYVKIKDTISGRELAQYCTSGAPAPLLLATHLAEIHFHSDADGGDTGFQL
                     HYSVEERVPGCGGVYTAKQGTISESSTANSEPGGVSCEYEIHLAVGEQIAIQFVRLQL
                     EPQDCLEVLDVTDEGASSLQEKICGSDAARLNPPAFTSQFNRLKIKFYARSGAFQLNY
                     RMACDLKLDSAEGTLTSPGYPNLSRSDRLCTYTIRTASNTVINLKRIDFQLNDGESLD
                     DDPGCPTTNLRINDGLNRQILGPFCGKNQPAEIFVSQTNFLQFHLTTDADSSGRGFKF
                     EYQSVSAGSDKCGGVHTLSGEHIRLPESSAGHYADDANCYWVIMAPANKAIRLHWLSF
                     DLEESLDCSFDFVEIYDSLSAQQNDEKAKPLAKLCGSHLPEDLVSHSRQLVIKFVSDY
                     SESDGGFELSYSFEERGNCGGHIHASSGELTSPDYPANYSSGLDCDWHLTGTLGHLLE
                     IQLENFALEESSNCSADYLEIRNGGADTSPLIGRFCGGNIPARIPSFSHEMRLHLHTD
                     SAINGRGFRLRWRVAAFGCGGNLRSNMGAISSPRYPNSYPHLSHCEWRISVHPGSAVS
                     LLVDDMDVEGLSSCYYDSVKIYAGIKQPNQTPDKVMCGSDQKNQLIQLETSEATVAFD
                     TDSSNAGRGFRISFKANCVRNLTATTGTIESLNYMEPFWETIPINCSWTIRAPKGNRI
                     RLEVSHLERHEAEQHMPSTQMPGGLYIMDGKNIESIIAPGALNASGEVLTVVHNASFV
                     NFQLDYRIDGCLQELRGESGSFDSPNRPHMYPNDLECYWLITVQRDSIIELTIFNMDL
                     EESVNCTKDALTVSNHKYSVADHERHCGSTDKLVITSAGHRLHVRFQSDGSHNGLGFS
                     ATYKTVKATCGGKISARNGVIESPNYPQSYPVSSHCEWQVEVSPHHQIVFEMQNLDLE
                     SGYDCNWDYLEGYDLAEDDTEGQQLFKVCGDEEQDTAIRKSATNLAVVRFISDDSVSR
                     KGFRLHFHESCGQTVTIDDTDFEYVEMSRQAPRNETCLFVFQSQEPNKHIIFTPTHVK
                     LREEAESRYPTEGDCLQMGVKIYEGTEAKGTPRLQFCRSHPPALISNGQALAISVPLL
                     LVEEFAGHYMTMDTACGSLYNALSGRFTSPYYPASYPPNIECTWLLEASAGNSISLAL
                     LSMDLEKSDGCNRDYLEVREETENGKLIGVYCGNEVPGVIHSSGSIWMKFKSDDDNVG
                     EGFMASYNYEHHNELNGTDGAIESPHYPSKFQDTDPYSWRITVEKEYVVAISVDHLRD
                     VDQPHLRFYDGYSDIGARIEMMGLEEPILSSTNVVYLTASRGPFRLTWERLSKEALRS
                     NRTAEEQTRLCGGRQLITIDRSAIGFHSPGYPNGYDNGLKCSWTLVPSDPAVHAIFTL
                     SHLDLEVFGGPNDCIADYVRISSGGDLQNWSELARLCTLPTAPNERIFHGKPYLRVEF
                     TTDPSVNRTGFNGLVRTGCGSEITATQGQVNITEVLRLNPRVNQDCVWTIKVRQGRRI
                     KIDFPDFQLQNSAANDCRNFLMLRNGNDEDSPFLGRGKYCEDVANEILNTTSNRAYVK
                     FHYASPPRFLMTFRFEELGHACSGRIQLTSSSDEKIISTPYYPHLPHPHSECIWIVQA
                     PPEHRIVLHFQGGFDLVEADGETRECQREYVLVNDGSTELKHEIGRYCGNRKPDSIYS
                     TGNQLRIRYYTDVSEPHMGFNASLKLARCGGSFHGSEGVIASPPRDLLQIHHGQEEGK
                     QLEECVYTIELEKGSTIELETEFMQIPRLANGSCSQRNHLRLEEMDAFAGSDGEEQEE
                     KVVDDLTVCGNEKHRLLSETNKIVFRYRFMDGIPAENQGFRFTYKSLGSRCGETINAN
                     VGVLQTPGYPMGVDHPMHCVWHVEVAKGRRVRLEILDFNMGNRNVSEGWRTPMAYGFG
                     HFRGRLTVANDFKMQSILGRYTADPPAEVMSSDNTMGIDAFLLPTGQTRGIKLRFSAS
                     GFSRCQQFGIQRDVTTEIVFQPVNVSIPIHCSYKIEPLVNSTIMIQVKQYNSSSVMMR
                     NTHLCSLLSPLRINRVDQVEHLMQRILCNYQAPTPGKPLPSIRVPFPIQLVVSSNNRN
                     SLSSLVLSYNMQSCGGVYILEPGDNMTLSQPTGMAEIQGPIDCAWAIGSYADAVNDDE
                     VVPQDIQLEVTVRGVNLPTPPLAPGSTEEACQHHYLKVYNGPDQNSPSLGLFCNQPAA
                     VNVVVERGLFFEYHSDSFAPNATFNVSVKYGSGCGGKLTYPYRAIDFSEQYKNNVECI
                     WEVEAASGYHIGLTFQGRFYIEDSAGCAKDYLLVQQRNESSGNWTDLQRICGRVAPEM
                     INTTSPYLRLIFRSDGDVVGDGFLAKFERNCGGLLYADDEERNLSSPGFPVSYEKDLQ
                     CNWTIVPRDPLSGGVLVSFLQFDLEQAPISVCLFDNVTVVTKDKDRDPEQVIICGVKH
                     NHEYRAKESISLIFKTDSSYSGRGFQVRYSSRLCGGVISRTGVVQSPRQHTDNNLPPG
                     SDCYWNLTAPVGYKFIVKFELLDFEPHTNCAYDGVEIFAGSIPDERQRRGRFCGRMNE
                     ELPVISIPQERGIIHSYSDERDPSRGFRAFVRIMQNCDEKISLNGSTRYVYSKFYNPE
                     GYDFGLDCHVVFRVNTDQQISVQFSHFHVQQSDDCSKDYVELRDGAGPFADIIGRFCG
                     QDQPPTLSTSRHTLFLRFVTDTRVTDSGFEVTINAVPRLCGSSEIALSSERQEVTIDS
                     PARTPGGNYANGVACFWRIKGDTPLRMNFVSFDLHGPDANGSCVEDYLKVYNSEDAEQ
                     VEQGFGSELVFNGQTSGHNHFDFATEHVYCGNVRPDTYYANANEVYLRFRSKGLEQRS
                     GFQVQVGLNSKSERHYDGLQGRVHLSQTDDCDITIRAPVNHTLSLYYTELIFGTYDCQ
                     TEYMEVFDRQNKSLQRFCSFVDVGKSLFSYSDELRLHMKTGSFLTSLDLTYLASPVEK
                     GPGCGGQFYNTEGIFANPFYPANVRNNSECQWIVRVPSNNKVFLNFEVFNLGSKTTCH
                     TDYLQVLEKDEAGEEVEVRRFCGEDNPKYYKSQRSQVVVRFHKTVNYDGVGWVIRFNG
                     VYSNYQIPRYLLGG"
     misc_feature    144..548
                     /gene="Cubn"
                     /note="N-terminal domain of cubilin and similar proteins;
                     Region: cubilin_NTD; cd22201"
                     /db_xref="CDD:412063"
     misc_feature    order(180..182,186..188,192..194,198..227,231..257,
                     261..278,291..293,300..305,309..314,321..326,330..335,
                     342..347,429..434,441..443,450..455,462..464,471..476,
                     483..485)
                     /gene="Cubn"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:412063"
     misc_feature    180..194
                     /gene="Cubn"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:412063"
     misc_feature    567..671
                     /gene="Cubn"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    675..797
                     /gene="Cubn"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(675..677,684..686,741..743)
                     /gene="Cubn"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    945..1067
                     /gene="Cubn"
                     /note="Calcium-binding EGF-like domain; Region: EGF_CA;
                     smart00179"
                     /db_xref="CDD:214542"
     misc_feature    order(945..947,954..956,1002..1004)
                     /gene="Cubn"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    1071..1202
                     /gene="Cubn"
                     /note="Calcium-binding EGF-like domain; Region: EGF_CA;
                     smart00179"
                     /db_xref="CDD:214542"
     misc_feature    order(1071..1073,1080..1082,1134..1136)
                     /gene="Cubn"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    1389..1490
                     /gene="Cubn"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    <1515..1613
                     /gene="Cubn"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    1632..1973
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(1656..1658,1662..1664,1668..1670,1749..1751,
                     1764..1766,1884..1886,1956..1958,1962..1964,1968..1973)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    1986..2318
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(2013..2015,2019..2021,2025..2027,2106..2108,
                     2121..2123,2229..2231,2301..2303,2307..2309,2313..2318)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    2337..2654
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cl00049"
                     /db_xref="CDD:412131"
     misc_feature    order(2361..2363,2367..2369,2373..2375,2454..2456,
                     2469..2471,2583..2585,2643..2645,2649..2651,2655..2657)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    2679..3014
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(2688..2690,2694..2696,2700..2702,2781..2783,
                     2796..2798,2922..2924,2997..2999,3003..3005,3009..3014)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    3036..3389
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(3063..3065,3066..3068,3072..3074,3156..3158,
                     3171..3173,3300..3302,3372..3374,3378..3380,3384..3389)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    3405..3740
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(3429..3431,3435..3437,3441..3443,3522..3524,
                     3537..3539,3651..3653,3723..3725,3729..3731,3735..3740)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    3753..4094
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(3783..3785,3789..3791,3870..3872,3885..3887,
                     4005..4007,4077..4079,4083..4085,4089..4094)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    4446..4751
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(4449..4451,4455..4457,4461..4463,4542..4544,
                     4557..4559,4668..4670,4740..4742,4746..4748)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    4770..5111
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(4794..4796,4800..4802,4806..4808,4887..4889,
                     4902..4904,5022..5024,5100..5102,5106..5108)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    5484..5807
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(5508..5510,5514..5516,5520..5522,5601..5603,
                     5616..5618,5727..5729,5796..5798,5802..5804)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    5808..6107
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cl00049"
                     /db_xref="CDD:412131"
     misc_feature    order(5832..5834,5838..5840,5853..5855,5934..5936,
                     5949..5951,6039..6041,6093..6095,6099..6101,6105..6107)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    6165..6518
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    6537..6875
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(6564..6566,6570..6572,6576..6578,6657..6659,
                     6672..6674,6795..6797,6858..6860,6864..6866,6870..6875)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    6894..7247
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(6921..6923,6936..6938,6942..6944,7023..7025,
                     7038..7040,7167..7169,7239..7241,7245..7247)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    7263..7664
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cl00049"
                     /db_xref="CDD:412131"
     misc_feature    order(7287..7289,7293..7295,7299..7301,7404..7406,
                     7419..7421,7569..7571,7647..7649,7653..7655,7659..7664)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    7677..8045
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(7707..7709,7713..7715,7794..7796,7809..7811,
                     7956..7958,8028..8030,8034..8036,8040..8045)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    <8652..8825
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cl00049"
                     /db_xref="CDD:412131"
     misc_feature    8844..9176
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(8871..8873,8877..8879,8952..8954,8970..8972,
                     9090..9092,9162..9164,9168..9170,9174..9176)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    9183..9533
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(9213..9215,9219..9221,9225..9227,9312..9314,
                     9327..9329,9447..9449,9516..9518,9522..9524,9528..9533)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    9540..9875
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    9912..10241
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(9930..9932,9936..9938,9942..9944,10023..10025,
                     10038..10040,10152..10154,10224..10226,10230..10232,
                     10236..10241)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    10254..10673
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(10281..10283,10299..10301,10305..10307,10386..10388,
                     10401..10403,10593..10595,10665..10667,10671..10673)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    10746..10952
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cl00049"
                     /db_xref="CDD:412131"
     misc_feature    11016..11348
                     /gene="Cubn"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cl00049"
                     /db_xref="CDD:412131"
     misc_feature    order(11040..11042,11046..11048,11052..11054,11133..11135,
                     11148..11150,11265..11267,11337..11339,11343..11345)
                     /gene="Cubn"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     polyA_site      11532
                     /gene="Cubn"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttccatcgga acggatcttt tttttttata gtgattatta aatgttttaa tttttgttcg
       61 gtgaaattgt ttggtaaagt gacaaaatga aaggatctgc gagaagcaga ctcctgttgt
      121 gtttggccat ctttattatt acggatattt ggccttttgc cgagggtttt gtcaactcgc
      181 caaaaattat aagcaaagat ggcaatttga tatttgagtc gggagcgaat cgcaatatta
      241 gttttcggtt gagcggaaat tcgcggctta ccatcaacga ggagttcgat gtgatggagc
      301 tcctgatggc caccggtggc ggcaagaagc ggccgaatgg cccgaaggat gaatggaaca
      361 ccggcgagga tttcgtggat gtgcgggagc tggcagatca gatggctgat ttcaagagaa
      421 gggtcttcgg ggtcaacggc ttggatgcca cgctgcgact gcagacgaac agaactcgcg
      481 gatccttggc cctaatgcgt cgcttccaga cccgactgag ggcagtggag aacaaggtgg
      541 atcggatgaa gacccagttg gagacgaata gctgtgccag tggaccctgc gagaacggag
      601 gaacctgcta caacaccttc aacggctttc gatgccagtg ccgcgcggcc ttcgagggca
      661 ccaagtgcga ggtggacgtc aacgagtgcg ccctgtacga gggcaccgac ctgggctgcc
      721 agaacggagg acagtgccag aatcagttcg gatcctacag ctgcctgtgc cagccgggct
      781 ggcatgggat gcactgcagc cagcgcaagg cggactgctc gcagtcgagt gcctgggagc
      841 tgtgtggcca cggatcctgc attccgagtg ccgatagcgc cggttatcgg tgcctctgtg
      901 agcctggctg gaagtccaat ggcgtgacgc ccgtttgtgg cgaggatgtg gacgagtgca
      961 gcgattcggc ggcctacagg ccgtgctcca ccaagtgcat caatctgccg ggcagcttca
     1021 cctgcgcccc ctgtgccgcc ggcctcacgg gaaacgggat cagttgccgg gatctggacg
     1081 agtgccagac gaacaacggc ggctgcagcc tcagtccgaa ggtggactgc ataaatacct
     1141 atggatcgta tcactgcggc gagtgtccgc tgggttggac gggcgatggc cggaagtgcg
     1201 agcggagtgc cgaggatttc gatatccaga ccggccagcg gcccagaagt tgtccggcga
     1261 gcaacaatcc ctgctacccg acagccagct gcttcctgat ctccggcacc gccacctgca
     1321 gatgtccggt gggcatggtg ggttcgggat acggtccaag tggctgcgtc aatggaacga
     1381 ccacgaattg cgctggaaat ccctgcctga acgatggcat ttgcctggac gccggaccct
     1441 cgaacttcac ctgcctgtgt cccagtggct tcaagcagcc gatctgcgag ccgatggcca
     1501 gtccctgcga cctgcatccc tgcaagaacg gcggacgctg ccggccgacg gtgggggcca
     1561 ctggcgatgg cttcgtctgc cagtgcatgc cgggctaccg gggtcgcctg tgcgacacgc
     1621 gattcagcag ctgcaacgga atgctggcgg cgcccagcgg acgtctgaaa tatccgccgg
     1681 agggcactgg atacgagcac aatgcccagt gcgcctgggt cattcgcacc aacgaatcgc
     1741 tggtggtcaa tgtcaccttc aatagcttcg atgtggagga ctcgacggag tgccgcttcg
     1801 attggctgca gatcaacgat ggccgctcgg cggctgccca gataatcgga cgctattgtg
     1861 gcaaccatct gccgcacggc gggaatatcg tctcttcagg gaatcaactg tatctttggt
     1921 tccgatccga caactcgacg gccagggagg gcttcgatct cagctggaat tcaatgcagc
     1981 cgcagtgcgg cggtcggctg gaatttgaga cccatggaac cctcgcctcg ccgggatcac
     2041 cgggcaatta tccaaagaac cgcgactgcc gctggcaact ggtggccccg accaacaagc
     2101 gcatcaagct caccttcttc tctctccagc tggagcagca cgacagctgc aatttcgatt
     2161 atgtgaagat caaggacacc atttccggcc gcgaactggc ccagtactgc accagcggag
     2221 ctccggcacc gctgctcctg gccacccacc tggccgagat ccacttccac tcggacgccg
     2281 atggcggcga cacgggcttc cagctgcact attcggtcga ggagcgggtg cccggctgcg
     2341 gtggcgtcta caccgccaag cagggcacca tttccgaatc ctccacagcc aattcggaac
     2401 ccggtggagt ttcctgcgaa tacgaaatcc atttggccgt gggcgagcag atagccattc
     2461 agtttgtgcg cctgcagctg gagccgcagg actgcctcga agtgctggac gtgacggacg
     2521 agggcgccag tagtttgcag gagaagatct gcggttcgga cgcggcccgc ttgaatccgc
     2581 ccgccttcac atcgcagttc aatcgcctca aaatcaagtt ctatgcccgc tcgggtgcct
     2641 tccagctgaa ctatcggatg gcctgtgacc tcaaactgga cagtgccgag ggcacactca
     2701 cctcaccggg ctatccaaac ctgtccagga gcgaccggct gtgcacctat acgattcgaa
     2761 cggcctccaa tacggttatc aacttgaaga ggattgattt tcaactgaac gacggcgaga
     2821 gtctagacga tgatcctggc tgtccaacca ccaatttgag gatcaacgat ggcctgaacc
     2881 gccagatcct tggacccttc tgtggcaaga accagccggc ggagatcttt gtcagccaga
     2941 ccaacttcct gcagttccac ctgaccacgg atgcggacag ttcgggtcgt ggcttcaagt
     3001 tcgagtacca gtcggtgtcg gcgggaagcg acaagtgtgg tggagtccac actctttccg
     3061 gtgagcacat ccgcctgccg gaatcctcgg cgggtcacta tgccgatgat gcgaactgct
     3121 actgggtgat aatggcgccg gccaacaagg ccatccggct gcactggctg agcttcgatc
     3181 tggaggaatc gttggactgc agctttgact ttgtggagat ctacgatagc ctttccgccc
     3241 agcagaacga tgagaaggcc aagccgctgg ctaagctatg tggctcccat ttgcccgagg
     3301 atctggtcag tcactcgcgt cagttggtca tcaaattcgt ctcggactac agcgaatcgg
     3361 acggcggctt cgaattgagc tactcgttcg aggaacgcgg caattgcggt ggtcacattc
     3421 atgcatccag tggtgagctc acctcaccgg attatcccgc caattattcc agcggtttgg
     3481 attgcgattg gcatttgacg gggacattgg gtcatctgct cgagattcag ctggagaact
     3541 ttgccctcga ggagtcgtcg aactgctcgg cggattattt ggagataagg aacggcggtg
     3601 ccgacacatc gccgctgata ggaaggtttt gtggagggaa tataccggcg aggataccca
     3661 gttttagcca cgagatgcga ctgcatctgc acacggattc ggcaattaat ggtcgaggct
     3721 tccgcctacg ttggcgcgtc gccgcctttg gatgcggcgg gaatctgcgc tccaatatgg
     3781 gagccatctc ctcgccccgc taccccaact cgtatcccca cctgtcgcac tgcgagtggc
     3841 ggattagtgt gcatcccggc tccgcagtct ccctgctcgt cgatgacatg gatgtggagg
     3901 gcttgagtag ctgctactac gacagcgtga agatctacgc gggcatcaag caacccaatc
     3961 agacgcccga caaggtgatg tgcggatcgg atcagaagaa tcaattgatt cagctggaga
     4021 cgagtgaggc gacggtggcc ttcgatacgg attcctcaaa tgctggaaga ggttttcgta
     4081 tatccttcaa ggcgaattgc gttagaaatc tgacggccac cacgggaacc atcgagagtc
     4141 tgaactacat ggagcccttc tgggagacga taccgatcaa ttgcagctgg accattcggg
     4201 cgcccaaagg caatcgcatt cgcctggaag tctcccattt ggagcgacac gaggcggagc
     4261 agcatatgcc gagtacccag atgcccggtg gtctgtatat catggatggg aaaaatatag
     4321 agagcattat tgccccagga gcactgaatg ccagtggcga agtgctgacc gtcgtccaca
     4381 atgccagctt tgtgaacttc cagctggact accgcatcga tggctgcctc caggagctgc
     4441 gcggcgaaag tggatccttc gattcgccaa atagaccgca catgtatccc aacgacctgg
     4501 agtgctactg gctcatcacc gtccagcgcg acagcatcat cgagctgacc atcttcaata
     4561 tggatctcga ggagagcgtc aattgcacca aggatgcgct gacggtgtcc aaccacaagt
     4621 actctgtggc ggaccacgaa cgccactgtg gatccacgga caagctggtc atcaccagtg
     4681 ccgggcacag gttgcatgtg cgattccaat cggatggttc gcacaatgga ctgggattct
     4741 ctgccaccta taaaactgtg aaagcaactt gcggtggcaa aatctcggcc cgcaacggag
     4801 tgatcgagtc tcccaactac ccgcaatcat atcccgtcag cagtcactgc gaatggcagg
     4861 tggaggtgtc gccgcaccac cagatcgtct tcgaaatgca gaaccttgat ctcgagtcgg
     4921 gctacgattg caactgggac tatttggaag gctacgatct ggccgaggac gacaccgagg
     4981 gtcagcagct gttcaaggtc tgcggcgatg aggagcaaga taccgccatt cgaaagtccg
     5041 ccaccaattt ggcggtggtg cgattcatca gcgatgactc cgtctcgagg aagggcttcc
     5101 ggctgcactt ccacgagtcg tgtggccaaa cggtgaccat cgacgatacc gacttcgaat
     5161 acgtggagat gtcgcgtcag gcgccgcgga acgagacctg tctgtttgtc ttccagtcgc
     5221 aggagcccaa caagcacatc atcttcacgc ccacccatgt gaagttgcgc gaggaggccg
     5281 agagccgata tcccaccgag ggcgactgcc tccaaatggg cgtgaagatc tacgagggca
     5341 cggaggccaa gggaacgccg cgcctccagt tctgccgctc gcatccgccg gcgttgatct
     5401 ccaacggcca ggcgctggcc atcagtgtgc ccctgctgct ggtcgaggag ttcgccggcc
     5461 actacatgac catggacacg gcctgcggca gcctgtacaa cgctctgtcc ggccggttca
     5521 cttcgcccta ctatcccgcc tcctatccac cgaacatcga gtgcacctgg ctgctggaag
     5581 cctccgcggg caattccatc agcctggcgc tgctatcgat ggacctagag aagtcggatg
     5641 gctgcaatcg ggattatctg gaggtgcgcg aggagacgga gaacggtaaa ctgatcggag
     5701 tctattgcgg caacgaggtg cccggggtga ttcactcgag cggttcgatc tggatgaagt
     5761 tcaagagcga cgatgacaat gtgggcgagg gattcatggc ctcttataac tatgaacacc
     5821 acaacgagct gaatggcact gacggcgcca tcgagtcgcc gcactatccg agcaaattcc
     5881 aggacaccga tccgtacagc tggcgcataa cggtggaaaa ggagtatgtg gtggcgatat
     5941 cggtggacca tttgagggat gtcgaccagc cacatttgcg tttctacgat ggctattcgg
     6001 acattggagc ccgcatcgag atgatgggtc tagaagagcc gatcctttcc agcaccaatg
     6061 tggtctattt gacggccagc cggggtccct tccgtttgac ctgggagcgt ctctccaagg
     6121 aggctcttcg ctcgaatcgc acggccgagg agcagacgcg cctgtgcggc ggccgtcagt
     6181 taatcaccat cgatcgttcg gccattggat tccattcgcc gggctatccg aatggctacg
     6241 acaatgggtt gaagtgctcg tggactttgg tgccctcgga tccggctgtg catgccatct
     6301 tcacgctgag tcacctggat ttggaggtct ttggcgggcc caacgattgc atagcggact
     6361 atgtgaggat ttcgagtgga ggtgatctgc agaactggtc ggaattggct agattgtgca
     6421 cgctgcccac tgctcctaat gagagaatct tccatgggaa accctatctt cgagtggagt
     6481 tcactacgga tcctagtgtc aatagaacgg gctttaatgg gcttgtacga acgggctgtg
     6541 gttccgagat tacggccacc caaggtcagg tgaacatcac cgaggttttg agactgaatc
     6601 cccgcgtgaa tcaggattgt gtgtggacta taaaggtgcg tcagggtcgc aggatcaaga
     6661 tcgatttccc cgactttcag ttacaaaaca gtgccgcaaa tgattgtcgc aatttcctaa
     6721 tgctacgcaa tggcaacgat gaggattcac cctttttggg ccgtggaaaa tactgtgagg
     6781 atgtggcgaa tgagatccta aacaccacct ccaatcgggc gtatgtcaag ttccactatg
     6841 cgagtcctcc ccgcttcctg atgaccttcc gcttcgagga actaggccac gcctgctcgg
     6901 gtcgcattca attgaccagc agctccgatg agaagatcat cagtacaccg tattatccac
     6961 atctgccgca tccccattcc gaatgcattt ggattgtaca ggcgccgccg gaacatcgga
     7021 tagtgctgca ttttcagggc ggattcgatc tggtcgaagc ggatggggag acgagggagt
     7081 gccaaaggga gtacgtcctg gtcaacgatg gcagcacgga gctgaagcac gagatcggtc
     7141 gctattgtgg caatcgcaaa ccggattcga tttactccac tggcaatcag ctgaggattc
     7201 gctactacac agatgtctcg gagccgcaca tgggtttcaa tgccagcctg aagttggccc
     7261 gttgcggtgg ctctttccat ggcagcgagg gcgtcatagc ctcaccaccg cgcgatctcc
     7321 tccagattca ccatggccag gaggaaggca agcagctgga ggagtgtgtg tacaccattg
     7381 agctggaaaa gggcagcacc atcgagctgg aaacggaatt tatgcagatc ccacggctgg
     7441 cgaatggcag ctgctcgcag cggaatcatc tgcggctgga ggagatggat gccttcgcag
     7501 gatcggatgg tgaagagcag gaggagaagg tcgtggatga tctgaccgtg tgcggcaacg
     7561 agaaacatcg cctgttgagc gagaccaaca agattgtgtt ccgctatcgg tttatggatg
     7621 gaattcccgc cgagaatcag ggcttccggt ttacttataa atccctgggc tcccgctgcg
     7681 gtgagaccat caacgccaat gtgggagtcc tccagacgcc tggctatccc atgggtgtcg
     7741 accatccgat gcactgcgtc tggcacgtgg aggtggccaa gggacggcga gttcgcctcg
     7801 agatcctcga ctttaatatg ggcaatcgga atgtgagcga aggttggaga accccaatgg
     7861 cctatggctt tggtcacttc cgtggacgtc tcaccgtggc caatgacttc aaaatgcagt
     7921 cgatcctggg cagatacacc gccgatccgc ctgccgaggt gatgtcctcg gacaatacca
     7981 tgggcatcga tgccttcctg ctgcccaccg gccagacgcg cggcattaag ctgcgattca
     8041 gtgcctcggg attcagcaga tgccagcagt tcggcatcca aagggatgtc accacggaga
     8101 ttgtgtttca gccggttaat gtcagcattc cgattcactg cagctacaaa attgagccgc
     8161 tggttaatag caccatcatg attcaggtga agcagtacaa ctcgagctct gtgatgatgc
     8221 gtaacacgca tctctgctcc ctcctctcgc cgcttaggat caaccgcgtc gaccaggtgg
     8281 agcacctaat gcagcgcatc ctctgcaatt accaggcacc cacaccgggc aaacccctcc
     8341 cctccatccg agtgcccttc cccatccaac tggttgtctc gtccaacaac cgcaactcgt
     8401 tgtccagcct cgtcctgtcc tacaacatgc agtcctgcgg cggcgtctat atcctggagc
     8461 cgggcgacaa tatgacgctg agccagccaa cgggaatggc ggagatacag ggacccatcg
     8521 actgtgcctg ggccattgga tcctatgcgg atgccgtcaa cgacgacgag gtggttccgc
     8581 aggacatcca gctggaggtg acggtgcgcg gtgtcaacct gccgacgcct ccgctggctc
     8641 cgggatccac ggaagaggcc tgccagcatc actatcttaa agtgtacaat ggacccgacc
     8701 agaactcacc ctcgctggga ttattctgca accagccggc ggctgtgaat gtggtggtgg
     8761 agcgtggcct gttctttgaa taccactcgg atagcttcgc acccaatgcg acattcaatg
     8821 tgtccgttaa atacggttcg ggatgcggcg gcaagctgac ctatccgtat cgagccatcg
     8881 atttcagtga gcagtacaag aataatgtcg agtgcatttg ggaggtggag gctgcctcgg
     8941 gctatcacat cggtctcacc ttccaagggc gtttctatat cgaggatagc gccggctgtg
     9001 ccaaggacta tctgctcgtc cagcagcgca acgaatcctc gggcaattgg acggatctcc
     9061 agaggatctg cggtcgtgtg gcccccgaaa tgatcaacac cacatcgccg tatctgcggc
     9121 taatctttcg ctccgacggc gatgtcgtgg gcgatggttt cctggccaaa ttcgagcgga
     9181 attgcggtgg ccttctctac gccgacgatg aggaaaggaa tctcagcagt ccgggctttc
     9241 cagttagcta cgagaaggat ctgcaatgca actggacgat cgtgccgagg gatccgctat
     9301 ccggtggcgt tctcgtgagc ttcctgcaat tcgatctgga acaggcaccc atatccgttt
     9361 gcctctttga caatgtcacc gtggttacca aggacaagga tcgggacccg gagcaggtga
     9421 tcatctgtgg cgtgaagcac aatcacgagt acagggccaa ggagtccata agtttgattt
     9481 tcaaaacgga tagcagctat tcgggccgag gattccaggt gcgttactcg agtcgccttt
     9541 gcggtggagt aatcagccga acgggagtgg ttcaatcacc caggcagcac acggataaca
     9601 acctcccgcc gggcagcgat tgctattgga atctcacggc accggtgggc tacaagttca
     9661 ttgtaaagtt cgaactcctt gactttgaac cgcacacgaa ttgtgcttat gatggggtgg
     9721 aaatctttgc gggttccatt cccgatgaac gacagcgaag gggacgcttc tgcgggcgga
     9781 tgaacgaaga gctcccggtg attagcattc cgcaggagcg gggcatcata cacagctact
     9841 cggatgagcg ggatccgtcg cggggattcc gtgccttcgt tcgcatcatg cagaattgcg
     9901 atgagaagat ctcgctaaat ggatccacgc gttatgtgta cagcaagttc tacaatcccg
     9961 agggctatga cttcggtctc gactgccatg tcgttttccg ggtgaacacg gatcagcaga
    10021 tcagcgtgca gttcagtcac ttccacgttc agcagtcgga tgactgttcc aaggattatg
    10081 tggagttgcg cgatggcgcc ggtccctttg ccgatatcat tggacgcttc tgtggccagg
    10141 atcagccgcc cacgctgagc acctcgcggc acacgctctt cctgcgcttc gtcaccgata
    10201 cgagggtcac cgattccggt ttcgaggtca ccatcaacgc cgtgccccgt ctgtgcggca
    10261 gttcggagat cgcgttgagt tcggagcggc aggaggtgac cattgactcg ccggccagga
    10321 cgccgggcgg taactacgcc aacggggtgg cctgcttctg gcggatcaag ggcgatacgc
    10381 cgctgcggat gaactttgtc agcttcgatc tacatggtcc cgatgccaat ggcagctgtg
    10441 tggaggacta cctgaaggtc tacaacagtg aggatgccga acaggtggag cagggctttg
    10501 gcagcgagct ggtcttcaat ggccagacct ccggacacaa tcactttgac tttgccacgg
    10561 agcacgtcta ctgcggcaat gtgaggccgg acacctatta cgccaacgcc aacgaggtgt
    10621 acctgcggtt ccgatcgaag ggcttggagc agcgctccgg attccaggtg caggtggggc
    10681 tgaactccaa gtccgagcgg cactacgatg gtctgcaggg aagggtacat ctttcgcaga
    10741 ccgacgattg cgatattacg atccgtgccc cggtcaatca cacgctgagt ttgtactaca
    10801 cggaactgat tttcggcacc tacgactgcc agacggaata tatggaggtc ttcgacaggc
    10861 aaaataaatc gctgcaacgc ttctgctcct ttgtggacgt cggcaagagc ctgttcagct
    10921 attcggatga actgcgactg cacatgaaga ccgggtcgtt tttgacctcg ctggatctca
    10981 cctatctggc cagtcccgtg gagaaggggc ccggatgcgg cggtcagttc tacaacaccg
    11041 agggcatctt cgccaatccc ttttatccgg ccaatgtgcg gaataactcc gagtgccagt
    11101 ggattgtccg ggtgccgagc aacaataaag ttttcctcaa tttcgaagtt ttcaatctgg
    11161 gctccaagac cacctgtcac accgactacc ttcaggtcct ggaaaaggac gaggctggcg
    11221 aggaagtaga agtgaggcgc ttctgtggcg aggacaatcc gaaatactac aagagccagc
    11281 gcagccaagt ggtcgtccgc ttccacaaga cggtcaacta cgatggcgtc ggctgggtga
    11341 tacgcttcaa tggggtgtac tccaactacc agatacccag atacttgctg ggcggttgaa
    11401 tccaaccctt gatcttgaaa ataatatgaa ataataattt ttattgtgaa gaatataata
    11461 tttttgcagg cctaaaaaga gtttaaggcg taattttaaa gtaaagcaaa taaaaaataa
    11521 aactttctta aa