Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157392 940 bp mRNA linear INV 09-DEC-2024 (GstT3), transcript variant X2, mRNA. ACCESSION XM_017157392 VERSION XM_017157392.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157392.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..940 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..940 /gene="GstT3" /note="Glutathione S transferase T3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108068036" CDS 75..827 /gene="GstT3" /codon_start=1 /product="glutathione S-transferase theta-1 isoform X2" /protein_id="XP_017012881.2" /db_xref="GeneID:108068036" /translation="MFWPQSPSDCFCVPFRQPTNLKMSSPIRYYYDLMSQPSRALFII FRLSNMPFEDCVVALRNGEHLTDDFKQQINRFQRVPCIHDNGYKLAESVAILRYLSAK GKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIET FRMHMERNLDVVEEVWLEGKDFLTGSTLSVADIFAACEIEQTRMADYDVRIKYPKIRA WLKRVRQSCNPHYDVAHEFVYKISGTGPQAKL" misc_feature 153..383 /gene="GstT3" /note="GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with...; Region: GST_N_Theta; cd03050" /db_xref="CDD:239348" misc_feature order(171..176,180..182,189..194,198..206,213..215, 255..257) /gene="GstT3" /note="C-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:239348" misc_feature order(177..182,264..269,306..311,345..350) /gene="GstT3" /note="GSH binding site (G-site) [chemical binding]; other site" /db_xref="CDD:239348" misc_feature 180..182 /gene="GstT3" /note="sulfate binding site [active]" /db_xref="CDD:239348" misc_feature order(297..299,333..338,342..347,354..356) /gene="GstT3" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:239348" misc_feature 423..797 /gene="GstT3" /note="C-terminal, alpha helical domain of Class Theta Glutathione S-transferases; Region: GST_C_Theta; cd03183" /db_xref="CDD:198292" misc_feature order(426..431,438..440,447..452) /gene="GstT3" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:198292" misc_feature order(456..458,468..473,480..485,489..494,504..506, 666..668,675..677) /gene="GstT3" /note="substrate binding pocket (H-site) [chemical binding]; other site" /db_xref="CDD:198292" misc_feature order(651..653,663..668,675..677,771..776,783..788) /gene="GstT3" /note="N-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:198292" polyA_site 940 /gene="GstT3" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acattttgct cttggtatat atttcttgct cagccagctg attccgattc cgatctgaat 61 cgaaacggag ctcaatgttt tggccccagt cgcccagtga ctgtttttgt gttcccttca 121 gacagccaac gaacctgaaa atgtcgtccc cgatccgcta ttactatgac ctgatgtcgc 181 agccctcgag ggcgttgttc attatcttcc ggctgagcaa catgcccttc gaagactgcg 241 tggtggctct gcggaatggc gagcacttga ccgacgactt caagcagcag attaaccgct 301 tccagcgcgt gccctgcatc catgacaacg gctacaagct ggcggagagc gtggccattc 361 tgcgctattt gagcgccaag ggcaaaatcc cggagcacct gtaccccaag tactttgtgg 421 accagagtcg cgtggatgag ttcctcgagt ggcagcacat gtcgctgcgg ctcacatgcg 481 ccatgtactt ccgcaccgtg tggctggagc cgctgctgac cggacgcact ccctcggagg 541 ccaagatcga gaccttccgc atgcacatgg agcgcaatct cgatgtggtc gaggaggtgt 601 ggctggaggg caaggacttc ctcaccggat ccactctttc cgtagcggac atctttgcag 661 cctgcgaaat cgaacagact cgcatggccg actatgatgt taggatcaag taccccaaaa 721 ttcgggcgtg gctgaagaga gtgcgccaaa gctgcaatcc gcactacgat gtggcccacg 781 agttcgtcta caagatctcg ggaacgggtc cgcaggccaa gctctgagat ccccagccac 841 agatcttcac cgagccattt ttgtacatag gatcattatc atttatacgg aataatataa 901 tatatagtta atgtgtaaat aaaactactt gtttccggtt