Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Glutathione S transferase T3


LOCUS       XM_017157392             940 bp    mRNA    linear   INV 09-DEC-2024
            (GstT3), transcript variant X2, mRNA.
ACCESSION   XM_017157392
VERSION     XM_017157392.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157392.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..940
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..940
                     /gene="GstT3"
                     /note="Glutathione S transferase T3; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108068036"
     CDS             75..827
                     /gene="GstT3"
                     /codon_start=1
                     /product="glutathione S-transferase theta-1 isoform X2"
                     /protein_id="XP_017012881.2"
                     /db_xref="GeneID:108068036"
                     /translation="MFWPQSPSDCFCVPFRQPTNLKMSSPIRYYYDLMSQPSRALFII
                     FRLSNMPFEDCVVALRNGEHLTDDFKQQINRFQRVPCIHDNGYKLAESVAILRYLSAK
                     GKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIET
                     FRMHMERNLDVVEEVWLEGKDFLTGSTLSVADIFAACEIEQTRMADYDVRIKYPKIRA
                     WLKRVRQSCNPHYDVAHEFVYKISGTGPQAKL"
     misc_feature    153..383
                     /gene="GstT3"
                     /note="GST_N family, Class Theta subfamily; composed of
                     eukaryotic class Theta GSTs and bacterial dichloromethane
                     (DCM) dehalogenase. GSTs are cytosolic dimeric proteins
                     involved in cellular detoxification by catalyzing the
                     conjugation of glutathione (GSH) with...; Region:
                     GST_N_Theta; cd03050"
                     /db_xref="CDD:239348"
     misc_feature    order(171..176,180..182,189..194,198..206,213..215,
                     255..257)
                     /gene="GstT3"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239348"
     misc_feature    order(177..182,264..269,306..311,345..350)
                     /gene="GstT3"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239348"
     misc_feature    180..182
                     /gene="GstT3"
                     /note="sulfate binding site [active]"
                     /db_xref="CDD:239348"
     misc_feature    order(297..299,333..338,342..347,354..356)
                     /gene="GstT3"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239348"
     misc_feature    423..797
                     /gene="GstT3"
                     /note="C-terminal, alpha helical domain of Class Theta
                     Glutathione S-transferases; Region: GST_C_Theta; cd03183"
                     /db_xref="CDD:198292"
     misc_feature    order(426..431,438..440,447..452)
                     /gene="GstT3"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198292"
     misc_feature    order(456..458,468..473,480..485,489..494,504..506,
                     666..668,675..677)
                     /gene="GstT3"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198292"
     misc_feature    order(651..653,663..668,675..677,771..776,783..788)
                     /gene="GstT3"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198292"
     polyA_site      940
                     /gene="GstT3"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acattttgct cttggtatat atttcttgct cagccagctg attccgattc cgatctgaat
       61 cgaaacggag ctcaatgttt tggccccagt cgcccagtga ctgtttttgt gttcccttca
      121 gacagccaac gaacctgaaa atgtcgtccc cgatccgcta ttactatgac ctgatgtcgc
      181 agccctcgag ggcgttgttc attatcttcc ggctgagcaa catgcccttc gaagactgcg
      241 tggtggctct gcggaatggc gagcacttga ccgacgactt caagcagcag attaaccgct
      301 tccagcgcgt gccctgcatc catgacaacg gctacaagct ggcggagagc gtggccattc
      361 tgcgctattt gagcgccaag ggcaaaatcc cggagcacct gtaccccaag tactttgtgg
      421 accagagtcg cgtggatgag ttcctcgagt ggcagcacat gtcgctgcgg ctcacatgcg
      481 ccatgtactt ccgcaccgtg tggctggagc cgctgctgac cggacgcact ccctcggagg
      541 ccaagatcga gaccttccgc atgcacatgg agcgcaatct cgatgtggtc gaggaggtgt
      601 ggctggaggg caaggacttc ctcaccggat ccactctttc cgtagcggac atctttgcag
      661 cctgcgaaat cgaacagact cgcatggccg actatgatgt taggatcaag taccccaaaa
      721 ttcgggcgtg gctgaagaga gtgcgccaaa gctgcaatcc gcactacgat gtggcccacg
      781 agttcgtcta caagatctcg ggaacgggtc cgcaggccaa gctctgagat ccccagccac
      841 agatcttcac cgagccattt ttgtacatag gatcattatc atttatacgg aataatataa
      901 tatatagtta atgtgtaaat aaaactactt gtttccggtt