Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157391 1011 bp mRNA linear INV 09-DEC-2024 (GstT3), transcript variant X1, mRNA. ACCESSION XM_017157391 VERSION XM_017157391.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157391.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1011 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1011 /gene="GstT3" /note="Glutathione S transferase T3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108068036" CDS 92..898 /gene="GstT3" /codon_start=1 /product="glutathione S-transferase theta-1 isoform X1" /protein_id="XP_017012880.2" /db_xref="GeneID:108068036" /translation="MSVSFLATLLGLSNDEDQLRLALEEVENPRVPFRQPTNLKMSSP IRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTDDFKQQINRFQRVPCIHD NGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTV WLEPLLTGRTPSEAKIETFRMHMERNLDVVEEVWLEGKDFLTGSTLSVADIFAACEIE QTRMADYDVRIKYPKIRAWLKRVRQSCNPHYDVAHEFVYKISGTGPQAKL" misc_feature 224..454 /gene="GstT3" /note="GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with...; Region: GST_N_Theta; cd03050" /db_xref="CDD:239348" misc_feature order(242..247,251..253,260..265,269..277,284..286, 326..328) /gene="GstT3" /note="C-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:239348" misc_feature order(248..253,335..340,377..382,416..421) /gene="GstT3" /note="GSH binding site (G-site) [chemical binding]; other site" /db_xref="CDD:239348" misc_feature 251..253 /gene="GstT3" /note="sulfate binding site [active]" /db_xref="CDD:239348" misc_feature order(368..370,404..409,413..418,425..427) /gene="GstT3" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:239348" misc_feature 494..868 /gene="GstT3" /note="C-terminal, alpha helical domain of Class Theta Glutathione S-transferases; Region: GST_C_Theta; cd03183" /db_xref="CDD:198292" misc_feature order(497..502,509..511,518..523) /gene="GstT3" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:198292" misc_feature order(527..529,539..544,551..556,560..565,575..577, 737..739,746..748) /gene="GstT3" /note="substrate binding pocket (H-site) [chemical binding]; other site" /db_xref="CDD:198292" misc_feature order(722..724,734..739,746..748,842..847,854..859) /gene="GstT3" /note="N-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:198292" polyA_site 1011 /gene="GstT3" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cggcgagcat ccacaacttg gggatatata agccgaaccg gctgcattca actcattcgc 61 tggcttaatt cagaggaact cggttctcgc catgtcggtg tcgtttttgg caactttact 121 tggtctcagc aatgacgagg atcagctgag attggccctt gaggaggtgg aaaatcccag 181 agttcccttc agacagccaa cgaacctgaa aatgtcgtcc ccgatccgct attactatga 241 cctgatgtcg cagccctcga gggcgttgtt cattatcttc cggctgagca acatgccctt 301 cgaagactgc gtggtggctc tgcggaatgg cgagcacttg accgacgact tcaagcagca 361 gattaaccgc ttccagcgcg tgccctgcat ccatgacaac ggctacaagc tggcggagag 421 cgtggccatt ctgcgctatt tgagcgccaa gggcaaaatc ccggagcacc tgtaccccaa 481 gtactttgtg gaccagagtc gcgtggatga gttcctcgag tggcagcaca tgtcgctgcg 541 gctcacatgc gccatgtact tccgcaccgt gtggctggag ccgctgctga ccggacgcac 601 tccctcggag gccaagatcg agaccttccg catgcacatg gagcgcaatc tcgatgtggt 661 cgaggaggtg tggctggagg gcaaggactt cctcaccgga tccactcttt ccgtagcgga 721 catctttgca gcctgcgaaa tcgaacagac tcgcatggcc gactatgatg ttaggatcaa 781 gtaccccaaa attcgggcgt ggctgaagag agtgcgccaa agctgcaatc cgcactacga 841 tgtggcccac gagttcgtct acaagatctc gggaacgggt ccgcaggcca agctctgaga 901 tccccagcca cagatcttca ccgagccatt tttgtacata ggatcattat catttatacg 961 gaataatata atatatagtt aatgtgtaaa taaaactact tgtttccggt t