Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Glutathione S transferase T3


LOCUS       XM_017157391            1011 bp    mRNA    linear   INV 09-DEC-2024
            (GstT3), transcript variant X1, mRNA.
ACCESSION   XM_017157391
VERSION     XM_017157391.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157391.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1011
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1011
                     /gene="GstT3"
                     /note="Glutathione S transferase T3; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108068036"
     CDS             92..898
                     /gene="GstT3"
                     /codon_start=1
                     /product="glutathione S-transferase theta-1 isoform X1"
                     /protein_id="XP_017012880.2"
                     /db_xref="GeneID:108068036"
                     /translation="MSVSFLATLLGLSNDEDQLRLALEEVENPRVPFRQPTNLKMSSP
                     IRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTDDFKQQINRFQRVPCIHD
                     NGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTV
                     WLEPLLTGRTPSEAKIETFRMHMERNLDVVEEVWLEGKDFLTGSTLSVADIFAACEIE
                     QTRMADYDVRIKYPKIRAWLKRVRQSCNPHYDVAHEFVYKISGTGPQAKL"
     misc_feature    224..454
                     /gene="GstT3"
                     /note="GST_N family, Class Theta subfamily; composed of
                     eukaryotic class Theta GSTs and bacterial dichloromethane
                     (DCM) dehalogenase. GSTs are cytosolic dimeric proteins
                     involved in cellular detoxification by catalyzing the
                     conjugation of glutathione (GSH) with...; Region:
                     GST_N_Theta; cd03050"
                     /db_xref="CDD:239348"
     misc_feature    order(242..247,251..253,260..265,269..277,284..286,
                     326..328)
                     /gene="GstT3"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239348"
     misc_feature    order(248..253,335..340,377..382,416..421)
                     /gene="GstT3"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239348"
     misc_feature    251..253
                     /gene="GstT3"
                     /note="sulfate binding site [active]"
                     /db_xref="CDD:239348"
     misc_feature    order(368..370,404..409,413..418,425..427)
                     /gene="GstT3"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239348"
     misc_feature    494..868
                     /gene="GstT3"
                     /note="C-terminal, alpha helical domain of Class Theta
                     Glutathione S-transferases; Region: GST_C_Theta; cd03183"
                     /db_xref="CDD:198292"
     misc_feature    order(497..502,509..511,518..523)
                     /gene="GstT3"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198292"
     misc_feature    order(527..529,539..544,551..556,560..565,575..577,
                     737..739,746..748)
                     /gene="GstT3"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198292"
     misc_feature    order(722..724,734..739,746..748,842..847,854..859)
                     /gene="GstT3"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198292"
     polyA_site      1011
                     /gene="GstT3"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cggcgagcat ccacaacttg gggatatata agccgaaccg gctgcattca actcattcgc
       61 tggcttaatt cagaggaact cggttctcgc catgtcggtg tcgtttttgg caactttact
      121 tggtctcagc aatgacgagg atcagctgag attggccctt gaggaggtgg aaaatcccag
      181 agttcccttc agacagccaa cgaacctgaa aatgtcgtcc ccgatccgct attactatga
      241 cctgatgtcg cagccctcga gggcgttgtt cattatcttc cggctgagca acatgccctt
      301 cgaagactgc gtggtggctc tgcggaatgg cgagcacttg accgacgact tcaagcagca
      361 gattaaccgc ttccagcgcg tgccctgcat ccatgacaac ggctacaagc tggcggagag
      421 cgtggccatt ctgcgctatt tgagcgccaa gggcaaaatc ccggagcacc tgtaccccaa
      481 gtactttgtg gaccagagtc gcgtggatga gttcctcgag tggcagcaca tgtcgctgcg
      541 gctcacatgc gccatgtact tccgcaccgt gtggctggag ccgctgctga ccggacgcac
      601 tccctcggag gccaagatcg agaccttccg catgcacatg gagcgcaatc tcgatgtggt
      661 cgaggaggtg tggctggagg gcaaggactt cctcaccgga tccactcttt ccgtagcgga
      721 catctttgca gcctgcgaaa tcgaacagac tcgcatggcc gactatgatg ttaggatcaa
      781 gtaccccaaa attcgggcgt ggctgaagag agtgcgccaa agctgcaatc cgcactacga
      841 tgtggcccac gagttcgtct acaagatctc gggaacgggt ccgcaggcca agctctgaga
      901 tccccagcca cagatcttca ccgagccatt tttgtacata ggatcattat catttatacg
      961 gaataatata atatatagtt aatgtgtaaa taaaactact tgtttccggt t