PREDICTED: Drosophila takahashii microfibril-associated

LOCUS       XM_017156644             900 bp    mRNA    linear   INV 09-DEC-2024
            glycoprotein 4-like (LOC108067564), mRNA.
ACCESSION   XM_017156644
VERSION     XM_017156644.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017156644.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 24% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..900
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..900
                     /gene="LOC108067564"
                     /note="microfibril-associated glycoprotein 4-like; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108067564"
     CDS             1..900
                     /gene="LOC108067564"
                     /codon_start=1
                     /product="microfibril-associated glycoprotein 4-like"
                     /protein_id="XP_017012133.3"
                     /db_xref="GeneID:108067564"
                     /translation="MTDTIAKWERELGIAKKETQIKDSQIKEQNKLLETENYKVIKLT
                     ENIESLRNKIKNKDAKDSQIDGLNNQIRSNAEKITNITDALAKCNPQDSCPIEGPSGI
                     YSMKIRGMNTFEAPCNSKGWLTIQKRFDGSEKFARNWNNFKKGFGNIMGEFFIGLERL
                     HVMTEARPHELYISLGMVNGSKAYAHYDDFKIASEEELYELKSLGIYSGTAGDSLTYH
                     KNKRFSTFDRKNDEHVHNCANGENGGWWYKSCSQSRLNGKFYKEGHTHDNKTNGISWG
                     SWHNYDFNYSLTFVEMMIRPKTL"
     misc_feature    289..891
                     /gene="LOC108067564"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    598..600
                     /gene="LOC108067564"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(685..687,691..693,697..699)
                     /gene="LOC108067564"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(709..711,718..723,748..753)
                     /gene="LOC108067564"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
ORIGIN      
        1 atgaccgaca ctatagccaa gtgggagaga gagttgggaa tagctaaaaa agaaacgcaa
       61 attaaggact ctcaaataaa agagcaaaat aaattgctag aaaccgaaaa ttacaaagtt
      121 attaaattga cagaaaatat tgaaagtctg agaaataaaa tcaaaaacaa ggatgccaaa
      181 gatagccaaa tcgatggcct caataatcag ataagatcga atgcggaaaa aataaccaac
      241 ataacagatg cacttgctaa gtgcaatcct caggattcct gtcccatcga aggaccaagt
      301 ggcatttact ccatgaaaat acgcggaatg aatacattcg aagcgccctg caactcaaaa
      361 ggttggctaa caattcaaaa acgttttgac ggctccgaaa agttcgctcg aaattggaac
      421 aacttcaaaa agggattcgg aaatataatg ggagagtttt tcatcggact ggagagattg
      481 cacgtgatga ctgaggcgcg accacacgaa ctttacatta gtcttggcat ggtaaatgga
      541 tccaaagcct acgctcatta tgatgacttt aagattgcaa gtgaagaaga attgtatgag
      601 cttaaatcac tggggattta tagtggtaca gccggcgatt ctctcacata tcataagaac
      661 aaaaggttca gcacgtttga caggaaaaat gacgaacatg tgcataactg cgccaacggt
      721 gaaaatggtg gatggtggta caagtcctgt tctcagagta ggctaaatgg aaagttctat
      781 aaagagggtc acacacacga taacaaaaca aatggaattt cttggggttc ctggcataac
      841 tacgatttca actactcgct tacctttgtt gaaatgatga taaggcccaa aacgttatag