Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017155307 1188 bp mRNA linear INV 09-DEC-2024 (GstT4), mRNA. ACCESSION XM_017155307 VERSION XM_017155307.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017155307.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1188 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1188 /gene="GstT4" /note="Glutathione S transferase T4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108066689" CDS 169..882 /gene="GstT4" /codon_start=1 /product="glutathione S-transferase theta-3" /protein_id="XP_017010796.1" /db_xref="GeneID:108066689" /translation="MSQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLT GEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYL AWQQTNMGVATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKF MLGDNISFADLSAICEIDQPKSIGYNTFQNRNKLARWYETVREELGPHYKEVLGEFET KLKGSGSGQQQGVAQAVKQ" misc_feature 181..408 /gene="GstT4" /note="GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with...; Region: GST_N_Theta; cd03050" /db_xref="CDD:239348" misc_feature order(199..204,208..210,217..222,226..234,241..243, 283..285) /gene="GstT4" /note="C-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:239348" misc_feature order(205..210,292..297,334..339,373..378) /gene="GstT4" /note="GSH binding site (G-site) [chemical binding]; other site" /db_xref="CDD:239348" misc_feature 208..210 /gene="GstT4" /note="sulfate binding site [active]" /db_xref="CDD:239348" misc_feature order(325..327,361..366,370..375,382..384) /gene="GstT4" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:239348" misc_feature 451..804 /gene="GstT4" /note="C-terminal, alpha helical domain of Class Theta Glutathione S-transferases; Region: GST_C_Theta; cd03183" /db_xref="CDD:198292" misc_feature order(454..459,466..468,475..480) /gene="GstT4" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:198292" misc_feature order(484..486,496..501,508..513,517..522,532..534, 694..696,703..705) /gene="GstT4" /note="substrate binding pocket (H-site) [chemical binding]; other site" /db_xref="CDD:198292" polyA_site 1188 /gene="GstT4" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agcagcaaaa gtccagcagt ccggttccaa agtagcgagc gatcacagtt tcgagtctgg 61 gaattccgaa tttcgaattt cgattgtatt ggaaataaaa agaagaagca gtagttcgaa 121 gttggaaatt tttgaagagc aacgaaaagc ctagtcagcg cccctaagat gtcgcagcca 181 ctcaagttct actttgattt cctcaaccaa tcgagccggg ccctctacat ccttttggag 241 gcatccaaaa tccccttcga ggccattccc atttcgatgc tcaaaggcga gcacttgacc 301 ggtgagttcc gggacaatgt gaaccggttc cgcaagctgc ccgcgatcac ggatcatggc 361 tatcagctgt ccgagaacgt ggccatcttc cggcatttgg ctcgcgagaa gctggtgccg 421 gagcactggt atccacgtcg ccatctcggc cgcagccgga tcgatgagta tttggcctgg 481 cagcagacca acatgggtgt cgccaccacc gagtatttcc agcaaaagtg gctggtgccc 541 tatctgcaga agacccggcc ggccgataat gcggtgaatc tcgccagcaa gcagctggag 601 cacacgctca acgagttcga gcagctattc ctcaactccc gcaaattcat gctcggcgac 661 aacatctcgt tcgcagacct cagcgccatc tgcgagatcg atcagcccaa atccatcggt 721 tacaatacgt tccagaaccg caacaagttg gcccgctggt acgagacggt ccgcgaggag 781 ctgggccccc actacaagga ggtgctcggg gagttcgaga ccaagctgaa gggcagtggc 841 agtgggcagc agcagggcgt ggcccaggcg gtgaagcaat agccgaggag ttaggaacct 901 cggaccgtcc acaaatcttg tttagttccc taaggcaatc gactatttaa ccgactatta 961 actttttttt tttacttttg tgattatata tgctcctcct atccgttaag tttcaacctt 1021 ccctaacaca ttattttctt ttattcgatc ccagaattgc tcatttgtgt aactctgtat 1081 cgtacctacg aaatcaaaaa caaaaacctt atatatataa aattagtact tagttgttaa 1141 ttatgtatct taattatacg tatataaaga acgcttatga ttgttaaa