Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Glutathione S transferase T4


LOCUS       XM_017155307            1188 bp    mRNA    linear   INV 09-DEC-2024
            (GstT4), mRNA.
ACCESSION   XM_017155307
VERSION     XM_017155307.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155307.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1188
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1188
                     /gene="GstT4"
                     /note="Glutathione S transferase T4; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108066689"
     CDS             169..882
                     /gene="GstT4"
                     /codon_start=1
                     /product="glutathione S-transferase theta-3"
                     /protein_id="XP_017010796.1"
                     /db_xref="GeneID:108066689"
                     /translation="MSQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLT
                     GEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYL
                     AWQQTNMGVATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKF
                     MLGDNISFADLSAICEIDQPKSIGYNTFQNRNKLARWYETVREELGPHYKEVLGEFET
                     KLKGSGSGQQQGVAQAVKQ"
     misc_feature    181..408
                     /gene="GstT4"
                     /note="GST_N family, Class Theta subfamily; composed of
                     eukaryotic class Theta GSTs and bacterial dichloromethane
                     (DCM) dehalogenase. GSTs are cytosolic dimeric proteins
                     involved in cellular detoxification by catalyzing the
                     conjugation of glutathione (GSH) with...; Region:
                     GST_N_Theta; cd03050"
                     /db_xref="CDD:239348"
     misc_feature    order(199..204,208..210,217..222,226..234,241..243,
                     283..285)
                     /gene="GstT4"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239348"
     misc_feature    order(205..210,292..297,334..339,373..378)
                     /gene="GstT4"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239348"
     misc_feature    208..210
                     /gene="GstT4"
                     /note="sulfate binding site [active]"
                     /db_xref="CDD:239348"
     misc_feature    order(325..327,361..366,370..375,382..384)
                     /gene="GstT4"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239348"
     misc_feature    451..804
                     /gene="GstT4"
                     /note="C-terminal, alpha helical domain of Class Theta
                     Glutathione S-transferases; Region: GST_C_Theta; cd03183"
                     /db_xref="CDD:198292"
     misc_feature    order(454..459,466..468,475..480)
                     /gene="GstT4"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198292"
     misc_feature    order(484..486,496..501,508..513,517..522,532..534,
                     694..696,703..705)
                     /gene="GstT4"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198292"
     polyA_site      1188
                     /gene="GstT4"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agcagcaaaa gtccagcagt ccggttccaa agtagcgagc gatcacagtt tcgagtctgg
       61 gaattccgaa tttcgaattt cgattgtatt ggaaataaaa agaagaagca gtagttcgaa
      121 gttggaaatt tttgaagagc aacgaaaagc ctagtcagcg cccctaagat gtcgcagcca
      181 ctcaagttct actttgattt cctcaaccaa tcgagccggg ccctctacat ccttttggag
      241 gcatccaaaa tccccttcga ggccattccc atttcgatgc tcaaaggcga gcacttgacc
      301 ggtgagttcc gggacaatgt gaaccggttc cgcaagctgc ccgcgatcac ggatcatggc
      361 tatcagctgt ccgagaacgt ggccatcttc cggcatttgg ctcgcgagaa gctggtgccg
      421 gagcactggt atccacgtcg ccatctcggc cgcagccgga tcgatgagta tttggcctgg
      481 cagcagacca acatgggtgt cgccaccacc gagtatttcc agcaaaagtg gctggtgccc
      541 tatctgcaga agacccggcc ggccgataat gcggtgaatc tcgccagcaa gcagctggag
      601 cacacgctca acgagttcga gcagctattc ctcaactccc gcaaattcat gctcggcgac
      661 aacatctcgt tcgcagacct cagcgccatc tgcgagatcg atcagcccaa atccatcggt
      721 tacaatacgt tccagaaccg caacaagttg gcccgctggt acgagacggt ccgcgaggag
      781 ctgggccccc actacaagga ggtgctcggg gagttcgaga ccaagctgaa gggcagtggc
      841 agtgggcagc agcagggcgt ggcccaggcg gtgaagcaat agccgaggag ttaggaacct
      901 cggaccgtcc acaaatcttg tttagttccc taaggcaatc gactatttaa ccgactatta
      961 actttttttt tttacttttg tgattatata tgctcctcct atccgttaag tttcaacctt
     1021 ccctaacaca ttattttctt ttattcgatc ccagaattgc tcatttgtgt aactctgtat
     1081 cgtacctacg aaatcaaaaa caaaaacctt atatatataa aattagtact tagttgttaa
     1141 ttatgtatct taattatacg tatataaaga acgcttatga ttgttaaa