Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017154364 1723 bp mRNA linear INV 09-DEC-2024 (Usp39), mRNA. ACCESSION XM_017154364 VERSION XM_017154364.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017154364.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1723 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1723 /gene="Usp39" /note="ubiquitin specific protease 39; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108066039" CDS 123..1607 /gene="Usp39" /codon_start=1 /product="ubiquitin carboxyl-terminal hydrolase 39" /protein_id="XP_017009853.1" /db_xref="GeneID:108066039" /translation="MAQTQAPAAKRMKLAQKPANPVEEDETPSVFNPKYRVCPYLDTI NRNLLDFDFEKLCSISLTRINVYACLVCGKYFQGRGTNTHAYTHSVGEAHHVFLNLHT LRFYCLPDNYEIIDSSLDDIKYVLNPTFTRQEISRLDQLQPKHSRTVDGVLYLPGVVG LNNIKANDYCNVVLHALSHVGPLRDYFLREQSYAHVKRPPGDSMFTLVQRFGELMRKM WNPRNFKAHVSPHEMLQAVVLWSSKRFQITEQGDPIDFLSWFLNTLHRALKGNKQPNS SILYKIFLGEMQIYTRKIPPVELDDAAKAQLLATEEYKDQVEHTNFIYLTCDLPPPPL FTDEFRENIIPQVNLYQLLGKFNGSAEKEYKTYKDNFMKRFEITRLPQFIILYIKRFT KNTFFLEKNPTIVNFPIKNVDFGDILGMRQRDKDVKDTKYNLVANIVHDGDPKKGTYR AHILHKANGQWYEMQDLHVTEILPQMITLTESYIQIYERCADAS" misc_feature 237..1586 /gene="Usp39" /note="A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl...; Region: Peptidase_C19M; cd02669" /db_xref="CDD:239134" misc_feature order(609..611,624..626,1464..1466,1518..1520) /gene="Usp39" /note="active site" /db_xref="CDD:239134" polyA_site 1723 /gene="Usp39" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtcgatagca ccatcgatga tttggctgct ctatttcaca tctctaaccg aaacaagctg 61 tcaacaaaac aattttaatt tttagaatta aatgaatttg tgaataagtc tggtacaaag 121 caatggcgca aacgcaagcc ccagccgcca agcgcatgaa gctggcccag aagccggcga 181 atcccgtcga ggaggatgag acgccgtccg tgttcaatcc gaagtaccgg gtgtgtccct 241 acctggacac catcaaccgc aacctgctgg actttgattt cgagaagctg tgcagcatct 301 cgctgacgcg gatcaatgtt tatgcctgtt tggtgtgcgg caagtacttc caggggcgcg 361 gaacgaacac ccacgcctac acgcactcgg tgggcgaggc gcaccatgtg ttcctcaacc 421 tgcacacgct gcgcttctac tgcctgccgg acaactacga gatcatcgac tcctcgctgg 481 acgacatcaa gtatgtgctg aatccgacgt tcacgcgcca ggagatcagc aggctggacc 541 agctgcagcc gaagcattcg cgcaccgtgg acggggtgct ctacttgccc ggcgttgtgg 601 gtctgaacaa catcaaggcg aacgactact gcaatgtggt gctgcacgcc ctctcccatg 661 tcggtccgct gagggattac ttcctgcggg agcagagcta tgcgcatgtc aagcggccgc 721 cgggggattc gatgttcacg ctggtccagc gattcgggga gctgatgcgc aagatgtgga 781 atccgcgcaa cttcaaggcg cacgtctcgc cgcacgagat gctgcaggcg gtggtgctgt 841 ggtcgagcaa gcgattccag atcaccgaac agggcgatcc cattgacttt ctgtcctggt 901 tcctgaacac cctgcatcgc gccctcaagg gcaacaagca gcccaattcg tctatactct 961 acaagatctt tctgggcgag atgcagatct atacgcgcaa aataccgccc gtggagctgg 1021 acgatgcggc gaaggcgcag ctgctggcca ccgaggagta caaggaccag gtggagcaca 1081 ccaatttcat ctacctcacc tgcgacctgc cgccgccgcc gctgttcacc gacgagttcc 1141 gcgagaacat cataccgcag gtgaatctct accagctgct gggcaagttc aatggcagcg 1201 ccgagaagga gtacaagacc tacaaggaca actttatgaa gcgcttcgag atcacccgcc 1261 tgccgcagtt cattatcctg tacatcaagc ggttcaccaa gaacaccttc ttcctcgaga 1321 agaatcccac cattgtgaat tttcccatca agaacgtcga ctttggcgac attctgggca 1381 tgcggcagcg cgacaaggat gtcaaggaca cgaaatacaa tctggtggcc aatattgtgc 1441 acgacggcga tcccaagaag ggcacctatc gcgcccacat cctgcacaag gccaacggcc 1501 agtggtacga gatgcaggac ctgcatgtca ccgagatcct gccccagatg atcacgctaa 1561 ccgagtccta cattcagatc tacgagcgct gtgccgacgc ctcgtgatcc ctttgaaatg 1621 tagtcccacc tagatgtatt ttgattacca aacaccatga tccaaaacta atatacgtag 1681 tagtcgcggt tagcgactat gtgaggcccg taaagagcag aaa