Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii neurogenic locus Notch protein


LOCUS       XM_017153659           10050 bp    mRNA    linear   INV 09-DEC-2024
            (N), mRNA.
ACCESSION   XM_017153659
VERSION     XM_017153659.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153659.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..10050
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..10050
                     /gene="N"
                     /note="neurogenic locus Notch protein; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 80 Proteins"
                     /db_xref="GeneID:108065618"
     CDS             697..8820
                     /gene="N"
                     /codon_start=1
                     /product="neurogenic locus Notch protein"
                     /protein_id="XP_017009148.2"
                     /db_xref="GeneID:108065618"
                     /translation="MQSPRSRRRSRAPNTWICCWINKMHAVASLSASLPLLLLTLAFA
                     NLPSTVRGTDTALVPLSCTSVVCQNGGTCVTQLNGKIYCACDSHYVGDYCQHRNPCNS
                     MRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCHNGGTCQLKTLQ
                     EYTCACANGYTGERCETKNLCASSPCRNGGTCTALAGSSSFTCSCPPGFNGDTCSFDI
                     EECLSNPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGVCRSNGLS
                     YDCKCPKGFEGKNCEQNFDDCLGHLCQNGGTCVDGISDYSCRCPPNFTGKFCQDDVDE
                     CAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVG
                     SFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDI
                     DECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPG
                     TFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINID
                     DCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSFK
                     CLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECH
                     SNPCNNGATCIDGINSYKCQCVPGFTGVHCEKNVDECISSPCANNGVCIDQVNGYKCE
                     CPRGFYDAHCLSDVDECASNPCVNEGRCEDSINEFICHCPPGYTGKRCELDIDECSSN
                     PCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVQNPCGNGGTCIDKVNGYKCVCK
                     VPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLS
                     SPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLC
                     VDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESS
                     CLNGGSCIDGINGYNCSCLAGFSGANCQYKLNKCDSNPCLNGGTCHEQRDEYTCHCPS
                     GFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADR
                     KGLSLRQLCNNGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCLDLIGA
                     YECKCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTVGIICEINKDD
                     CKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSNAGTLDCVQLVNN
                     YHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQD
                     CDSNPCRVGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNPCAQGAACEDLLGD
                     FECFCPSKWKGKRCDIYDVSYPGWNGGNDRYAADLEQQRAMCEKRGCNEKQTNGICDS
                     ECNTYACNFDGNDCSLGINPWANCTANECWNKFKNGKCNEECNNAACHYDGHDCERKL
                     KSCDSLFDAYCQKHYGDGFCDYGCNNAECSWDGLDCENKTQSPVLAEGAISVVMLMNE
                     EQFREIQAQFLRNMSHMLRTTVRLKKDAFGRDMITKWRDNQPVAEIDNTDFARKNKIL
                     YTQQVYQTGIQIQIEIDNRKCTECFTHAVEAAEFLAATAAKHQLRNDFQIHSVGVVKN
                     PGDDDSGEPPANVKYVITGIILVIIALAFAGMVLSTQRKRAHGVTWFPEGFRAPAAVM
                     SRRRRDPHGQEMRNLNKQVGLQSQGVGQTGAHWSDDESDMPLPKRQRSAPISVINQQG
                     LGNNGGYASDHTMVSEYEEADQRVWSQAHLDVADVRAIMTPPAHQDGGIGLSGISNKH
                     DVDARGPHGQTPLMIAVRGGGGLDTGEDIENNEDSTAQVISDLLAQGAELNATMDKTG
                     ETSLHLAARFARADAAKRLLDAGADANCQDNTGRTPLHAAVAADAMGVFQILLRNRAT
                     NLNARMHDGTTPLILAARLAIEGMVEDLITADADINAADNSGKTALHWAAAVNNTEAV
                     NILLMHHANRDAQDDKDETPLFLAAREGSYEACKALLDNFANREITDHMDRLPRDVAS
                     ERLHHDIVRLLDEHVPRSPQMLSMTPQAMIGSPPPGQQQQQQQLITQPTVISAGNGNG
                     NGNASGKQSSQSAKQKAAKKAKLIEGSPDNGLDATGGGSLRRKASSKKTSAASKKAAT
                     LNGQLTGAAQAQAQAAQAAAAAAAAAAAAAAMTMSHELEGSPVGVGMGGNLPSPYDTS
                     SMYSNAMAAPLANGNPNTGAKQPPSYEDCIKNAQSLQSLQGNGLDMIKLDNYGYSMGS
                     PFQQELLNGQGLGMNGNGQRNGVVGGVLPGGLCGMGGLTGAGNGNSHEQGLSPPYSNQ
                     SPPHSVQSSLALSPHAYLGSPSPAKSRPSLPTSPTHIQAMRHATQQKQFGGSNLNSLL
                     GGANGGGVVGGGGGNGGQGPQNSPVSLGIISPTGSDMGIMLAPPQSSKGSAIMQTLSP
                     QQQQQQQQQQQQQQQHQQQQQQQQQQQQQQQQQQLGGLEFGSAGLDLNGFCGSPDSFH
                     SGQMNPPSIQSSMSGSSPSTNMLSPSSQHNQQAFYQYLTPPSQHSGGHTPQHLVQTLD
                     SYPTPSPESPGHWSSSSPRSNSDWSEGVQSPAANNLYISGGHQANKGSEAIYI"
     misc_feature    1231..1338
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    1345..1452
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(1345..1347,1354..1356,1396..1398)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    1474..1569
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    1573..1683
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(1573..1575,1582..1584,1624..1626)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    1687..1803
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(1687..1689,1696..1698,1747..1749)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2041..2154
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2041..2043,2050..2052,2095..2097)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2158..2268
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2158..2160,2167..2169,2209..2211)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2272..2382
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2272..2274,2281..2283,2323..2325)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2386..2496
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2386..2388,2395..2397,2437..2439)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2500..2607
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2500..2502,2509..2511,2548..2550)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2614..2721
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    2725..2835
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2725..2727,2734..2736,2776..2778)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2839..2946
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2839..2841,2848..2850,2890..2892)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    2953..3063
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(2953..2955,2962..2964,3004..3006)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    3067..3177
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(3067..3069,3076..3078,3118..3120)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    3181..3291
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(3181..3183,3190..3192,3232..3234)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    3415..3525
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(3415..3417,3424..3426,3469..3471)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    3532..3642
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(3532..3534,3541..3543,3583..3585)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    3646..3756
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(3646..3648,3655..3657,3697..3699)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    3775..3870
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    3886..3978
                     /gene="N"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    4246..4353
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    4357..4467
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(4357..4359,4366..4368,4408..4410)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    4471..4581
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(4471..4473,4480..4482,4522..4524)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    4585..4701
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(4585..4587,4594..4596,4642..4644)
                     /gene="N"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    4708..4815
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    4945..5046
                     /gene="N"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    5110..5220
                     /gene="N"
                     /note="Domain found in Notch and Lin-12; Region: NL;
                     smart00004"
                     /db_xref="CDD:197463"
     misc_feature    5239..5343
                     /gene="N"
                     /note="LNR domain; Region: Notch; pfam00066"
                     /db_xref="CDD:459658"
     misc_feature    5377..5463
                     /gene="N"
                     /note="LNR domain; Region: Notch; pfam00066"
                     /db_xref="CDD:459658"
     misc_feature    5476..5640
                     /gene="N"
                     /note="NOTCH protein; Region: NOD; pfam06816"
                     /db_xref="CDD:462014"
     misc_feature    5839..6102
                     /gene="N"
                     /note="juxtamembrane and transmembrane (JMTM) domain found
                     in Drosophila melanogaster neurogenic locus Notch protein
                     (dNotch) and similar proteins; Region: JMTM_dNotch;
                     cd21706"
                     /db_xref="CDD:411989"
     misc_feature    order(5842..5850,5857..5865,5923..5928,5932..5934,
                     5938..5964,5971..5976,5983..5991)
                     /gene="N"
                     /note="putative polypeptide substrate binding site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:411989"
     misc_feature    6382..6660
                     /gene="N"
                     /note="Ankyrin repeats (3 copies); Region: Ank_2;
                     pfam12796"
                     /db_xref="CDD:463710"
     misc_feature    6418..6561
                     /gene="N"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    6523..7134
                     /gene="N"
                     /note="Ankyrin repeat [Signal transduction mechanisms];
                     Region: ANKYR; COG0666"
                     /db_xref="CDD:440430"
     misc_feature    6568..6660
                     /gene="N"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    6667..6762
                     /gene="N"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    order(6766..6768,6772..6774,6784..6789,6796..6804,
                     6808..6813,6823..6825,6832..6834,6859..6861,6865..6867,
                     6871..6873,6883..6888,6895..6903,6907..6912,6922..6924,
                     6931..6933,6958..6960,6964..6966,6970..6972,6982..6987,
                     6994..7002,7006..7011,7021..7023,7030..7032,7057..7059)
                     /gene="N"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293786"
     misc_feature    6766..6861
                     /gene="N"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    6865..6960
                     /gene="N"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    6964..7059
                     /gene="N"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     polyA_site      10050
                     /gene="N"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtttttttga gtggacgaaa cggttgtgag agcggacgat cgcaaagtca gaggaacctg
       61 gaaaacacac agcacagtta tttttttttt tgaaagtgag tgcaaggaaa accgaaacaa
      121 aatagaggat acaaaataaa aaacaacaag aaaaaatacg ggaatggcgc tacaaaaaac
      181 gccgctaaaa aaggagttct tgtggaaggg ataacaacac aaaaagaaga agaaagaaac
      241 aaggattttt cgaaaagtgt atctgacccg agtcgcgtgt gtgtgagtga gaaggcgagt
      301 gagtcgaacg agggagagag caatacgcaa gcgtgcggcg tcggtttgaa tttgaatttt
      361 tgctcgatcc tcacaatata aaaaaggcaa caaaaaagag cgctgttttt ttttgccatt
      421 ttttttttaa tgtttcaaaa cggaaaatgt cgccgtcgtc gggagagtgc ctcctcttag
      481 ttgatcaaat aaagctttaa gatctaaagt tttgaaacta tcaaagcgaa aaaccgcccg
      541 caaaatagaa ataaaaaact ttaaaatttc catatcctcg aaataaaata catcctcaaa
      601 gagagagacc aaagaggaga gcccgcaaag aaaccgagca gagaagagga agaggtgaaa
      661 aactggaaaa gtggttaact ggaaaactgg attacaatgc aatcgccgcg cagccgacgt
      721 cgcagtcgcg caccaaacac ttggatttgt tgttggatta acaaaatgca cgccgttgcg
      781 tcgctgtcgg cgtcgctgcc tctgctgctg ctgacgctgg cgtttgcgaa tttgccaagc
      841 accgtccgcg gaactgatac cgcgttggtg cccctttcct gcacaagtgt ggtctgccag
      901 aatggcggaa cctgcgtcac acaactcaat ggcaaaatct actgcgcttg cgattcacac
      961 tatgtcggcg actactgtca acaccgaaat ccgtgcaatt cgatgcgttg ccagaatggc
     1021 ggcacctgtc aggtgacctt tcgcaacggt cgtcctggca tctcctgcaa gtgtcccctg
     1081 ggcttcgacg agtccttgtg cgaaatagcg gtgccgaatg cctgcgatca tgtgacctgt
     1141 cacaacggag gcacctgtca gctgaagacc ctgcaggagt acacgtgtgc gtgtgccaat
     1201 ggctatacag gtgagcgatg cgagacgaag aatctgtgcg ccagttcgcc ctgccggaat
     1261 ggaggcacct gcaccgcctt ggccggaagc agcagcttca cctgctcctg tccaccggga
     1321 ttcaatggtg acacctgctc cttcgacatc gaggagtgcc tgtcgaatcc ctgcaagtac
     1381 ggcggcacct gcgtcaacac ccacggatcc taccaatgca tgtgtcccac gggctacacg
     1441 ggcaaggatt gcgacaccaa gtacaagccc tgctcaccat cgccctgcca gaatggcgga
     1501 gtttgccgat cgaacggtct gtcctacgac tgcaagtgcc ccaaaggttt cgagggcaag
     1561 aactgcgagc agaacttcga cgactgcctg ggtcacctgt gccaaaacgg aggcacctgc
     1621 gtggacggga tctcggacta cagctgccgg tgtccgccca acttcacggg aaagttctgc
     1681 caggacgacg tggacgagtg cgcccagcgg gatcatccgg tgtgccagaa tggagccacc
     1741 tgtacgaata cccatggctc ctacagctgc atctgcgtga atggctgggc gggattggat
     1801 tgcagcaaca atacggatga ctgcaagcag gcagcgtgtt tctatggagc cacctgcatc
     1861 gatggcgtcg gtagcttcta ctgccagtgc accaagggaa agacggggtt gctctgccac
     1921 ctggacgacg cctgcacctc gaatccctgc cacgcggatg ccatttgcga tacgagtccg
     1981 atcaacggat cctatgcctg ttcctgtgcc accggctaca agggcgtcga ttgctccgag
     2041 gacattgacg aatgcgatca gggatccccc tgcgagcaca acggcatttg tgtgaatacc
     2101 ccgggtagct atcgctgcaa ttgctcccag ggattcacgg gtccgcgctg cgaaacgaac
     2161 atcaacgaat gcgaatcgca tccttgccag aatgagggat cctgcctgga tgatcccggc
     2221 acctttcgtt gcgtctgcat gccgggattc acgggcaccc agtgcgagat tgacattgat
     2281 gaatgccaat cgaatccctg cctgaatgac ggcacctgcc acgacaagat caacggcttc
     2341 aagtgcagtt gtgctttggg tttcaccgga gccaggtgtc aaatcaacat agacgactgc
     2401 cagtcgcaac cgtgcaggaa tcgtggaatt tgccatgatt ccatagctgg ttatagctgc
     2461 gaatgtccac cgggatacac aggaaccagt tgcgaaatca acatcaatga ctgcgactcg
     2521 aatccctgcc acaggggcaa gtgcatcgac gatgtgaata gcttcaagtg tttgtgtgat
     2581 ccaggatata cgggatacat ttgccagaag cagatcaacg aatgcgaatc gaatccctgc
     2641 cagtttgatg gccactgcca ggatcgcgtg ggcagctact attgccaatg tcaggcgggc
     2701 acaagtggca agaattgcga ggtgaacgtg aacgaatgcc acagcaatcc ctgcaacaat
     2761 ggggcaacct gcattgatgg tattaattcc tataaatgcc aatgtgtccc aggattcacg
     2821 ggcgtccatt gcgagaagaa tgtggacgag tgcatcagca gtccgtgtgc gaataatggt
     2881 gtatgcatcg atcaggttaa tgggtataaa tgcgaatgcc cacggggatt ctacgatgcc
     2941 cattgcctca gtgacgtcga cgaatgcgcc tcgaatcctt gcgtaaacga aggtcgctgc
     3001 gaggacagca tcaacgagtt catctgccac tgcccaccag gatacacggg caagcgatgc
     3061 gaactggaca tcgatgagtg cagcagcaat ccctgccagc atggaggaac ttgctacgac
     3121 aaactgaacg cctttagttg ccaatgtatg cctggttata cgggtcagaa atgtgagacc
     3181 aacatagatg actgcgtcca gaatccctgt ggaaatggag gcacttgcat agacaaggtg
     3241 aatggttaca agtgcgtctg caaggtgccc ttcaccggac gcgattgcga gagcaaaatg
     3301 gatccctgtg ccagtaatcg ctgcaagaat gaggcaaagt gtacgccgag ttcgaatttc
     3361 ctggactttt cctgcacctg caaactgggc tacacgggac gctactgcga tgaggatatc
     3421 gatgagtgct ccttgagttc tccctgccgc aatggagcca gttgtttgaa tgttcctggt
     3481 tcgtatagat gcctctgcac caagggttac gagggtcgcg attgcgccat caacacggat
     3541 gactgcgcct cgtttccctg ccaaaatgga ggaacctgtc tggatggaat cggtgactac
     3601 agctgcctgt gcgtggatgg tttcgatggc aagcactgcg agacggatat caatgagtgt
     3661 ttgagtcaac cctgccaaaa tggagccacc tgcagtcagt atgtgaatag ttatacctgc
     3721 acttgtccct tgggattctc ggggattaat tgccagacga atgatgaaga ttgcacagag
     3781 agttcgtgcc tcaatggagg aagctgcatt gatggaatca atgggtataa ctgtagctgc
     3841 ttagcgggat tctccggagc caattgccag tacaagctga acaagtgcga ctcgaatccc
     3901 tgcctgaatg gaggaacctg tcatgagcag agggatgagt acacgtgcca ctgccccagt
     3961 ggattcaccg gaaagcagtg ctccgagtac gtggactggt gtggccaatc accgtgtgaa
     4021 aatggagcca cctgcagcca gatgaagcat cagtttagct gcaaatgctc cgccggctgg
     4081 acgggcaagc tgtgcgatgt gcagaccatt tcctgccagg atgcagcgga taggaaaggc
     4141 ctgagtctcc gccagctgtg caataatgga acgtgcaagg attacgggaa tagccatgtg
     4201 tgctactgtt cgcaaggata tgcgggtagc tattgccaaa aggagattga cgagtgccag
     4261 tcgcaacctt gtcagaatgg aggaacctgc ttggatttga taggagccta tgaatgcaag
     4321 tgtcgccagg gtttccaggg gcaaaattgc gaactgaaca tagatgattg tgccccgaat
     4381 ccctgccaga atggaggaac ctgccacgat cgcgtgatga actttagttg cagctgtcca
     4441 ccgggaacag tgggcattat ttgcgagatc aacaaggatg actgcaaacc gggagcctgt
     4501 cacaacaatg gtagctgcat tgatcgcgtg ggaggctttg aatgcgtctg ccagccggga
     4561 tttgtgggtg cccgttgcga gggagacatc aatgagtgcc tgagtaatcc ctgctcgaat
     4621 gcggggactc tcgactgcgt tcagttggtg aataactatc actgcaactg cagacccggt
     4681 cacatgggtc gtcactgcga gcacaaggtg gatttctgtg cccagagtcc ttgccagaat
     4741 ggcggtaact gcaatatccg gcagagtggc caccactgca tctgcaataa tggtttctac
     4801 gggaagaact gcgagttatc tggccaggat tgcgattcga atccctgccg cgtgggcaac
     4861 tgtgtggtgg ccgacgaggg attcggctat agatgtgaat gtccgcgagg aaccctaggt
     4921 gaacactgcg agatcgacac gctggacgag tgctcgccga atccctgcgc ccagggagcc
     4981 gcctgcgagg atctcctggg ggatttcgag tgcttctgcc cgagcaaatg gaagggcaag
     5041 cgttgcgata tctacgatgt gagctatccg ggttggaatg gtggcaacga tcgatatgca
     5101 gccgatttgg agcaacagcg agcgatgtgc gagaagcgtg gatgcaacga gaagcagacg
     5161 aatggcattt gcgattcgga gtgcaatacg tatgcctgta atttcgatgg caacgactgc
     5221 tcgctgggca tcaatccgtg ggccaattgt acggctaacg agtgctggaa taagttcaag
     5281 aatggcaaat gcaacgagga gtgcaacaat gcggcatgcc actacgatgg gcatgattgc
     5341 gagaggaaac tgaagagttg cgatagcctt ttcgatgcct actgccaaaa gcactatggc
     5401 gatggcttct gcgactatgg atgcaacaat gccgagtgca gttgggatgg tttggattgc
     5461 gagaataaaa cacagtcgcc tgttttggca gagggagcaa tctcggtggt aatgctgatg
     5521 aacgaggagc aattccgtga gattcaggcg cagtttttga ggaacatgag ccacatgctg
     5581 agaactacag tgaggctaaa gaaggatgcc tttggcaggg atatgataac caaatggagg
     5641 gataatcaac cggtagccga gattgataac actgattttg ccaggaaaaa caagatatta
     5701 tatacgcagc aggtttatca aacaggcata cagatacaga ttgaaattga taacaggaaa
     5761 tgcactgaat gctttaccca tgcggtggag gcagctgaat tcctggctgc cacggcggca
     5821 aagcatcagt tgcgcaacga ttttcagatc cacagcgtgg gcgtggtcaa gaatccgggg
     5881 gatgatgata gcggagaacc tcctgctaat gttaagtatg tcatcacagg gattatcctg
     5941 gtcatcatcg ccttggcctt tgctggaatg gtcttgagca cgcagagaaa gcgcgcacat
     6001 ggcgtcacct ggttccccga aggattccgc gccccagcgg ctgtgatgtc ccgcaggaga
     6061 agagatcccc atggtcagga gatgaggaac ctcaacaagc aagtgggtct gcagtcgcag
     6121 ggcgtcggcc aaacaggagc ccattggtcg gatgatgagt ccgatatgcc gctgcccaag
     6181 cgacaaagga gtgctcccat ctctgtgata aaccagcagg gattgggcaa caatggtggc
     6241 tatgccagcg atcacacgat ggtcagcgag tacgaggagg cggaccagag ggtctggtcg
     6301 caggcccacc tggatgtggc cgatgtgagg gccataatga cgccgccggc gcatcaggat
     6361 gggggaattg gattatctgg catctccaac aaacacgatg tggatgccag aggaccacat
     6421 ggtcagacgc ctctgatgat tgctgtgcgc ggaggcggag gcctggatac cggcgaggat
     6481 atcgagaaca acgaggacag cacggcgcag gtgatctccg atctgctggc ccagggagcc
     6541 gaactgaatg ccaccatgga caaaacgggc gagacgtcgc tgcatttggc ggcgcgattc
     6601 gctcgagcgg atgccgccaa gcggctgctg gacgccggag cggatgccaa ttgccaggac
     6661 aacacgggaa ggacgccact ccacgcggcc gtggctgccg atgcaatggg tgtgttccag
     6721 atactcctgc gcaatagggc caccaatttg aatgccagga tgcatgatgg caccactcct
     6781 ttgatactcg ccgctcgcct ggccatcgag ggaatggtgg aggatcttat caccgccgat
     6841 gcggatatta atgcagcgga taattcagga aagaccgctc tccattgggc agcggcagtg
     6901 aataatacag aggcggtgaa tatactcctc atgcatcatg ccaatcggga tgcccaggat
     6961 gacaaggatg agacgccgct gtttttggcc gcccgcgagg gaagctacga ggcctgcaag
     7021 gcgctgctgg ataactttgc caatcgcgag atcaccgatc acatggaccg actgccacgc
     7081 gatgtggcca gcgagcgact gcatcacgat atcgttaggt tgctggatga gcatgttcct
     7141 cgatcaccgc aaatgctcag catgacgccg caggcgatga ttggatcacc gccgccggga
     7201 caacagcagc agcagcagca gctgatcacc cagcccacgg tgatttccgc cggaaacgga
     7261 aatggcaatg gcaacgccag cggcaagcag agcagccagt cggccaagca gaaggcggcc
     7321 aagaaggcca agttgatcga gggcagcccc gacaacggac tcgatgccac cggcggtgga
     7381 agtctgcgtc gcaaggccag ttcaaaaaag acaagtgcgg cctcaaaaaa ggccgccacc
     7441 ttgaatggcc agctgactgg agcggcccag gcccaagccc aagcggccca agctgcggcg
     7501 gcggcggcgg cagcagcggc ggcagcagct gccatgacca tgtcccacga actggaggga
     7561 tcgccggtgg gcgtgggcat gggcggcaat ctgcccagcc cctacgacac cagctccatg
     7621 tactcgaacg cgatggccgc tccgctggcg aacggcaatc cgaacacggg cgccaagcag
     7681 ccgccgagct atgaggattg catcaagaat gcgcaatcgc tgcagtcgct gcagggcaac
     7741 ggcctggaca tgataaagct ggacaactac ggctactcga tgggctcgcc atttcagcag
     7801 gagctgctca acggccaagg actcgggatg aatgggaacg ggcagcggaa cggcgtcgtc
     7861 ggcggcgtcc tgcccggcgg tctgtgcgga atgggcggcc tgaccggagc cggaaacgga
     7921 aatagccacg agcagggact cagtccgccg tactcgaacc aatcgccgcc gcattcggtg
     7981 cagagcagcc tggcgctttc gccccacgct tatttgggct ctccatcgcc ggccaagtcg
     8041 cgacccagtt tgcccacctc gccaactcac atccaggcga tgaggcatgc cacacagcag
     8101 aagcagttcg gtggcagcaa tctgaacagc ctgctgggcg gtgccaacgg agggggcgtg
     8161 gtgggcggag gaggaggcaa cggtggacag gggccgcaga actcgccggt gagcttgggc
     8221 atcatctcgc cgacgggcag cgatatgggc atcatgctcg ccccgccgca atcctcgaaa
     8281 ggcagtgcaa taatgcagac gctatccccc cagcaacagc aacagcagca gcagcaacag
     8341 cagcaacaac agcagcatca gcagcagcaa cagcaacagc agcaacagca gcagcagcaa
     8401 cagcagcagc aactcggagg cctggagttc ggttcagcgg gcttggacct gaatggattt
     8461 tgtggatctc cggactcatt tcactcgggt caaatgaatc cgccctcgat acaaagttca
     8521 atgtccggct cgtcgccgtc gaccaacatg ctgtcgccgt cgtcgcagca caaccagcag
     8581 gccttctacc agtacctaac gccaccgagc cagcattccg gcggccacac gccgcagcat
     8641 ttggtccaga cgctggacag ctacccgacg ccctcgccgg agtcgcccgg ccactggtcc
     8701 tcctcctcgc cgcgatcgaa ttccgattgg agcgagggcg tccagtcgcc ggcggccaat
     8761 aatctctaca tttccggcgg ccatcaggcc aacaagggat ccgaggccat ctacatttga
     8821 ccgtgaaccc cgaaaccgat gatatggaaa tggagatggt ttgccaagga taacagcaga
     8881 ggggactctt aaagagtccg cggctacgtt ctatctaaaa tgctatataa taataataat
     8941 aatattaata tgtaattctc taatccctac gattatgtat tttttcaacg cgacttttat
     9001 tttttttttt atcgtgtgtg tctataagtt ttagcattta gatcgaaata cgcaattctg
     9061 gctgaagaag aagcgtcata aattgtagta acttaaatta tttttatgct tgttgtacag
     9121 tgcgcgccga tcgcatatat atatatataa agatatatat atatatatat ctactcatag
     9181 atataccagt taagagctcg ttttgtggcg cattttattt tattgtcgta acatcgtcgg
     9241 agcttccagt aaaaaagaaa agaaagaaat tataaccagc gagaggagaa actaaactta
     9301 gcgcaaattc tgattgatcg atttaacgtt ggtgggacat ttgtagttgt aagcgaaccc
     9361 attatatcac taggccataa gtctaggcta agtttttatc gaattctaca tttaattatg
     9421 gcccacatgc tatataaata tatacatata tttcgtagtt ctgtaggttt cgaaactgaa
     9481 gtgcttatat aaacaaaatt gttagacgta caccgcatca aacctttttt tttacaccaa
     9541 gttttttttt ttattattat tattatgact attatgtatt attacatatt gactaagcta
     9601 aactgtaaaa agattctcat aactgtttga tttaagttga caaaaaaaaa acaaaggaaa
     9661 ttgcaaaaat tatacaaaaa tccccagcga gaaagtataa tgctgattaa aagagaaaaa
     9721 aagcacaaaa aacaacaaaa aagacagtaa ccagccaagt tttctatata tataaggccc
     9781 cccattatga tctaagttga taaatagata ttttcaaaaa atatacaacc agaaaaagac
     9841 actaaaaagt ccacaaatac gattttgccg ttcgatttgc tctatttata atgcgaacgg
     9901 tatgctttct ttcgtctata ttttgtgtaa gtttttaatg tgtaaattgt aaaattattt
     9961 gttttcctaa cttaaacagc aagacagcaa aacaaaaatg caaacttttt gagataaata
    10021 ataaatatta aataattatt ttaaaaacaa