Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Dihydrouridine synthase 2 (Dus2),


LOCUS       XM_017151784            1619 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017151784
VERSION     XM_017151784.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151784.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1619
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1619
                     /gene="Dus2"
                     /note="Dihydrouridine synthase 2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108064304"
     CDS             85..1515
                     /gene="Dus2"
                     /codon_start=1
                     /product="tRNA-dihydrouridine(20) synthase [NAD(P)+]-like"
                     /protein_id="XP_017007273.2"
                     /db_xref="GeneID:108064304"
                     /translation="MQSMRLPIQILARSLGISMKTRQRLDYRDKLILAPMVRVGTLPM
                     RLLALEMGADIVYTEELVDLKLIKSIRRPNAALGTVDFVDPSDGTIVFRTCAQETSRL
                     VLQLGTSDPNRALAVGQLLQRDIAGLDINMGCPKEFSIKGGMGAALLSDPAKAALILR
                     TLCSGLDIPVTCKIRILPDVAQTIDLVQQLAATGIAAIGIHARTRDERPQHPAHPEVL
                     RAVAQAVDIPIIANGGSKSMHCHEDLRKFQADCGAASVMVARAAQINVSIFRKEGLLP
                     MDELIERYLRLCVDYDNAPHNAKYCVQSILRELQETPRGKRFLQCQTLQQMCEIWQLG
                     DYCRRRQRELRTLGNSGRAEVEPPEAQAKRQKLEEISSGDEYSNVICRNMPFLRSTYP
                     SDNHLPKTQLYVHAAREGKSPPAYETQQCDKLFRSICSFDGQRFSSSFWEKNKKQAEQ
                     GAALVALLHLGQLEAQVLRDNGSLLN"
     misc_feature    172..897
                     /gene="Dus2"
                     /note="Dihydrouridine synthase-like (DUS-like) FMN-binding
                     domain. Members of this family catalyze the reduction of
                     the 5,6-double bond of a uridine residue on tRNA.
                     Dihydrouridine modification of tRNA is widely observed in
                     prokaryotes and eukaryotes, and also...; Region:
                     DUS_like_FMN; cd02801"
                     /db_xref="CDD:239200"
     misc_feature    order(184..192,262..264,397..399,475..477,601..603,
                     685..687,778..780,784..786,859..864)
                     /gene="Dus2"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239200"
     misc_feature    order(397..399,484..489,601..603,607..609,682..687,
                     691..696,781..786,862..864)
                     /gene="Dus2"
                     /note="active site"
                     /db_xref="CDD:239200"
     misc_feature    order(484..486,607..609,685..687,691..693)
                     /gene="Dus2"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239200"
     misc_feature    order(487..489,601..603,682..684,694..696,781..786)
                     /gene="Dus2"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239200"
     misc_feature    1273..1467
                     /gene="Dus2"
                     /note="double-stranded RNA binding motif of
                     tRNA-dihydrouridine(20) synthase [NAD(P)+]-like (DUS2L)
                     and similar proteins; Region: DSRM_DUS2L; cd19871"
                     /db_xref="CDD:380700"
     misc_feature    order(1273..1275,1279..1284,1291..1296,1303..1308,
                     1321..1326,1345..1347,1348..1353,1357..1359,1411..1422,
                     1429..1434)
                     /gene="Dus2"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:380700"
     polyA_site      1619
                     /gene="Dus2"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ggtggcccaa tcgcgtgcat agacccccca aaaaaacggc gtgcgaacag ctgaaagatt
       61 cgattcgatt cgctccataa atccatgcaa tccatgcgac tgcccatcca gatcctcgcg
      121 aggagtctcg gcatcagcat gaagacgcgc cagcggctgg actaccgcga caagctcatc
      181 ctggcgccga tggtgcgcgt gggcacgctg ccgatgcgac tgctcgcctt ggaaatgggc
      241 gcggatatcg tttacacgga ggagttggtc gatctcaagc tgatcaagag cattcgcagg
      301 ccaaatgccg ccctgggaac cgtggacttt gtggatccct ccgacggcac catagttttt
      361 cgcacctgcg cccaggagac ctcccgtttg gtcctccagc tgggcaccag tgatcctaac
      421 cgcgctttgg ccgtgggcca gctgctgcag cgcgacattg ccgggctgga catcaacatg
      481 ggctgcccca aggagttctc catcaagggc ggcatgggcg ccgctctgct ttcggatccc
      541 gccaaggcgg ccctcatcct gcgcaccctg tgctccggcc tggacattcc ggtcacctgc
      601 aagattcgca tcctgccgga tgtcgcgcaa accattgatt tggtccagca actggccgcc
      661 acgggcattg cagcgatcgg gattcatgcg aggacgcgcg acgagcgacc gcagcatccg
      721 gcgcatcccg aagttctgcg cgccgttgcc caggcggtgg acataccgat catagcgaat
      781 ggcggctcca agtccatgca ttgccacgag gatttgcgca aatttcaggc ggattgcgga
      841 gcagccagcg tgatggtggc gcgggctgcc cagataaatg tgagcatctt tcgcaaggag
      901 ggcctgctgc ccatggatga gttgatcgag agatacctcc gcctgtgcgt cgactacgac
      961 aatgcgccgc acaacgccaa gtactgtgtg cagagcattt tgcgtgagct gcaggagacg
     1021 ccgcgcggca agcgctttct gcagtgccag acgctgcagc agatgtgcga gatttggcag
     1081 ctgggcgact actgccgaag gaggcagcgc gaactccgca cgctgggcaa ctcgggaagg
     1141 gcggaagtgg agccgccaga ggcgcaggcc aagcggcaga agctggagga gatttcttca
     1201 ggagatgagt actctaacgt catttgccgc aacatgccct ttctgcgctc cacctacccg
     1261 agcgacaatc atttaccgaa aacgcagctc tatgttcatg ccgcgcggga gggcaaatcc
     1321 ccgccagcct acgagacgca gcagtgcgac aagctcttcc gttcgatctg ctcgttcgac
     1381 gggcagcgct tcagcagctc cttctgggag aagaacaaga agcaggcgga gcagggcgcc
     1441 gcgttggtgg ccctcctcca tctcggacag ctggaggcgc aggttctgcg cgacaatggc
     1501 agcctgctca actgatggat tgtttattaa tgctaatgat acctactccc cttgattgtt
     1561 tgcctttaat gtgggtgcta aatgtatatt ttctaaataa aagaagcaca taagggtta