Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Caspase-8 Dredd (Dredd),


LOCUS       XM_017151162            1619 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X2, mRNA.
ACCESSION   XM_017151162
VERSION     XM_017151162.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017151162.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1619
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1619
                     /gene="Dredd"
                     /note="Caspase-8 Dredd; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 5 Proteins"
                     /db_xref="GeneID:108063889"
     CDS             237..1580
                     /gene="Dredd"
                     /codon_start=1
                     /product="caspase-8 isoform X2"
                     /protein_id="XP_017006651.2"
                     /db_xref="GeneID:108063889"
                     /translation="MTRSEADFPPSDLLQQYAKSRPDAWRRHLVEALCIVGARQVLRR
                     LGFRWQELRLHYLPHVAEVALHVHPLLKSLYRICEQLTLAQSGRLVLDVGEKVARQQA
                     GDPLRFYDPTYLEIFLLDWLTRGSLRLGDINAAGSDVQLLIEHLKFNDLQEQAKLLID
                     TINSNAPEAAPPAPPLVAIKQETQLDSSASSVSSASSSRRGNALELSREKAGIVLIIN
                     QQRFHRNVSEDLKQYLPSKKLQNRAGTDVDKQRLTEVFSAMNYQVEARDNVDHLDMVQ
                     LVRSACDRSLLQDSLVVCILSHGFEEAVYGANSIALRIADIENVLCSYETLYNKPKLL
                     IIQACQEEALREGEENKPFKIDVTTQSPSQHVNMVRAMSTVNGFSALRHTHSGSWFIQ
                     GLCDAIDQHSASEHIADILTIVTNEVSQKRGKNDESMVPKFNSSFRQHVYFPPRL"
     misc_feature    849..1571
                     /gene="Dredd"
                     /note="Caspase, interleukin-1 beta converting enzyme (ICE)
                     homologues; Cysteine-dependent aspartate-directed
                     proteases that mediate programmed cell death (apoptosis).
                     Caspases are synthesized as inactive zymogens and
                     activated by proteolysis of the peptide...; Region: CASc;
                     cl00042"
                     /db_xref="CDD:444667"
     misc_feature    order(960..962,1131..1133,1245..1247,1266..1268,
                     1371..1388,1398..1403)
                     /gene="Dredd"
                     /note="substrate pocket [chemical binding]; other site"
                     /db_xref="CDD:237997"
     misc_feature    order(1128..1130,1251..1253)
                     /gene="Dredd"
                     /note="active site"
                     /db_xref="CDD:237997"
     misc_feature    order(1350..1352,1359..1361,1368..1370,1437..1439,
                     1461..1463,1479..1481,1518..1520,1533..1538,1542..1544,
                     1551..1556)
                     /gene="Dredd"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:237997"
     polyA_site      1619
                     /gene="Dredd"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 actttttcgc tttttcatgc gaatttgatc ttacaaactg gtactttccc gcacaacatg
       61 gccggagcga atctgctgac ccagctggac gccatccacc tggacgacct ggtctacgtg
      121 gagcgcgacc tgaactttgc ccagaagagc aatccctctt ccaggtgggc ctctgcttcc
      181 tgctccacgg ggacgaccac tcgcacgcca cctacatcct gcagaagctg ctggtgatga
      241 cgcgatcgga agccgacttc ccgcccagcg atctcctcca gcagtacgcc aaatcccggc
      301 cagacgcctg gcggaggcac ctcgtggagg ccctgtgcat tgtgggcgcc cgccaggtgc
      361 tgcgccgcct gggcttccgc tggcaggagc tgcggctgca ctacctgccc cacgtcgccg
      421 aggtggccct gcatgtgcat ccgctgctga agagtctcta caggatctgc gagcagctga
      481 cgctggcgca gagcggtcgc ttggtcctgg atgtgggcga gaaggtggcg cgtcagcagg
      541 cgggcgatcc cctgcgcttc tacgatccca cttacctgga gatcttcctg ctggactggc
      601 tcaccagggg atccctgcgg ctgggcgaca tcaatgccgc cggcagcgat gttcagcttc
      661 tgattgagca cctcaagttc aatgatctgc aggagcaggc caagctgctt atagacacca
      721 tcaacagcaa tgccccggag gcggctcctc ctgctcctcc actggtggcc atcaagcagg
      781 agacgcaact ggacagctca gccagctcag ttagctcagc cagctcctcc cggcgaggga
      841 atgccctcga gctgagtcgc gagaaggcgg gcatcgtgct gatcatcaac cagcaaaggt
      901 tccaccgcaa tgtcagcgag gatctcaagc aatacctgcc gtctaagaag ttgcagaacc
      961 gcgcaggaac ggatgtggat aagcaaagac tgaccgaggt cttctccgcg atgaactacc
     1021 aggtggaggc gcgcgataat gtggatcatt tggacatggt gcagctcgtg cgcagtgcct
     1081 gcgacagatc cctgctgcag gactcgctgg tcgtgtgcat cctgagccac ggcttcgagg
     1141 aggccgtcta cggggccaac agcatcgccc tgcggatagc ggacatcgag aacgtgctct
     1201 gcagctacga gacgctgtac aacaagccca agctgctcat catccaggcc tgccaggagg
     1261 aggcgctccg ggagggcgag gaaaacaagc cattcaagat cgatgtgacc acccagtcgc
     1321 ccagtcagca tgtcaacatg gtgcgcgcca tgtccacggt gaacggattc tccgccctgc
     1381 ggcacacgca ctcgggcagc tggttcatcc aggggctctg cgatgccatc gatcagcact
     1441 ccgccagcga acacattgcc gacatcctga ccatcgtcac caacgaggtt tcccagaagc
     1501 gcggcaagaa cgacgagtcc atggtgccca agttcaacag ctcgtttcgc cagcacgtct
     1561 actttccacc tcgcctgtga ttgcaatatt atttcgttaa ataaaagtgt ctaaagtta