Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RAS oncogene family member Rab40


LOCUS       XM_017149864            1549 bp    mRNA    linear   INV 09-DEC-2024
            (Rab40), transcript variant X2, mRNA.
ACCESSION   XM_017149864
VERSION     XM_017149864.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017149864.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1549
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1549
                     /gene="Rab40"
                     /note="RAS oncogene family member Rab40; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108062967"
     CDS             253..1020
                     /gene="Rab40"
                     /codon_start=1
                     /product="ras-related protein Rab-40C isoform X2"
                     /protein_id="XP_017005353.2"
                     /db_xref="GeneID:108062967"
                     /translation="MGTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGN
                     AYKTTTILLEGKRVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDR
                     WLKEVDEHAPGIPKVLVGNRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCDFNIRE
                     SFCELARMALHRNGMEHIWRSNKVLTLQELCCRTIVRRTSVYAIDSLPLPPSVKSTLK
                     SYALTTSQCFNSLTQSSKSKNRCKTPTSGSRNSCAIA"
     misc_feature    268..774
                     /gene="Rab40"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    304..327
                     /gene="Rab40"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(310..330,451..453,613..618,622..624,703..711)
                     /gene="Rab40"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     misc_feature    373..375
                     /gene="Rab40"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    385..393
                     /gene="Rab40"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    442..453
                     /gene="Rab40"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(448..453,499..504)
                     /gene="Rab40"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    613..624
                     /gene="Rab40"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    703..711
                     /gene="Rab40"
                     /note="G5 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    796..924
                     /gene="Rab40"
                     /note="SOCS (suppressors of cytokine signaling) box. The
                     SOCS box is found in the C-terminal region of CIS/SOCS
                     family proteins (in combination with a SH2 domain), ASBs
                     (ankyrin repeat-containing proteins with a SOCS box), SSBs
                     (SPRY domain-containing proteins...; Region: SOCS;
                     cl02533"
                     /db_xref="CDD:470605"
     misc_feature    order(799..816,832..834,853..855,871..873)
                     /gene="Rab40"
                     /note="elongin B/C interaction [active]"
                     /db_xref="CDD:239641"
     polyA_site      1549
                     /gene="Rab40"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 accgcccctc gcaagttgta ccatctctat agagatgagc aaaattgcaa ttttcctaaa
       61 attcgcaggg gaaaaccaca aataatcagc aacgaaacga aataaatgcg agatagagcc
      121 gcgatttgca acaaatgaat cgcggcgact gaaagcgcga aaaacccgcc gaggaaaagt
      181 cgccagagcg agggaaatcg ctcatctcta ttacaaatac gaaaatgaaa ttgcgtgcat
      241 tctaaatgcc acatgggaac catgaccaag gactacgact atctgctgaa ggttctgctg
      301 gtgggcgaca gcgatgtggg caagcacgag atcctctcga acctggagga tccctccacg
      361 gagagcccct tttgcagcgg gaacgcctac aagaccacca ccatcctgct ggagggcaag
      421 cgggtgaagc tgcagctgtg ggacacctcc ggccagggac gcttctgcac gatcatacgc
      481 tcctattcgc gcggcgccca gggcatcatc ctcgtctacg acatcaccaa caagtggagc
      541 ttcgacggga tcgatcgctg gctcaaggag gtcgacgagc acgcccctgg catcccgaag
      601 gtgcttgtgg ggaatcgcct gcatttggcc ttcaagcgac aggtggcggc caaacaggcc
      661 gagacctacg ccagccgcaa caatatgtcc tgcttcgaga tatcgcccct gtgcgacttc
      721 aacatccgcg agtccttttg cgagctggca cggatggcgc tgcatcgcaa tggcatggag
      781 cacatctggc gcagcaataa ggtgctgacg ctgcaggagc tgtgctgcag gacgatcgtg
      841 cggaggacga gcgtgtacgc gatcgattcg ctgccgttgc cgccgtcggt gaagtcgacg
      901 ctcaagtcat acgcgctgac cacctcgcag tgcttcaact cactgaccca gagctcaaag
      961 agcaagaacc gctgcaagac gccgacgagc ggcagccgga atagctgtgc gatcgcgtga
     1021 tcgttgcctt gtaggccgcc gcccagctgc ctacgccgcc acgcccccca accgacatta
     1081 actttaattg agctctactt atgtactata ggctaacaca cacaccacac accacacaca
     1141 cacacacact acacactcac ccacatggtt attatcttat ttgtttcatc gacattgata
     1201 tttgtggcca acaatgttta ctttttacac agtaaagctt acattaattt aattattaac
     1261 ccccgtccca ttttccccat tccctctctt ctctcttttg cattactcta atgttgttaa
     1321 tattattatg tttgtataat tataatattt aaagcatcaa acacatcaac ataacaaaaa
     1381 aaagaaaaaa acaacagcaa gtgaaaatca atttttatat gcataaaaaa attttttttt
     1441 gtttggttac catcggttta aaatattctt agagatgtat tgtaattgaa gcgaattcag
     1501 caagagaagc gcacacaaag gcgaattgat aaagataatt cataatgaa