Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017149864 1549 bp mRNA linear INV 09-DEC-2024 (Rab40), transcript variant X2, mRNA. ACCESSION XM_017149864 VERSION XM_017149864.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017149864.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1549 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1549 /gene="Rab40" /note="RAS oncogene family member Rab40; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108062967" CDS 253..1020 /gene="Rab40" /codon_start=1 /product="ras-related protein Rab-40C isoform X2" /protein_id="XP_017005353.2" /db_xref="GeneID:108062967" /translation="MGTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGN AYKTTTILLEGKRVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDR WLKEVDEHAPGIPKVLVGNRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCDFNIRE SFCELARMALHRNGMEHIWRSNKVLTLQELCCRTIVRRTSVYAIDSLPLPPSVKSTLK SYALTTSQCFNSLTQSSKSKNRCKTPTSGSRNSCAIA" misc_feature 268..774 /gene="Rab40" /note="Members of the P-loop NTPase domain superfamily are characterized by a conserved nucleotide phosphate-binding motif, also referred to as the Walker A motif (GxxxxGK[S/T], where x is any residue), and the Walker B motif (hhhh[D/E], where h is a...; Region: P-loop containing Nucleoside Triphosphate Hydrolases; cl38936" /db_xref="CDD:476819" misc_feature 304..327 /gene="Rab40" /note="G1 box; other site" /db_xref="CDD:206648" misc_feature order(310..330,451..453,613..618,622..624,703..711) /gene="Rab40" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206648" misc_feature 373..375 /gene="Rab40" /note="G2 box; other site" /db_xref="CDD:206648" misc_feature 385..393 /gene="Rab40" /note="Switch I region; other site" /db_xref="CDD:206648" misc_feature 442..453 /gene="Rab40" /note="G3 box; other site" /db_xref="CDD:206648" misc_feature order(448..453,499..504) /gene="Rab40" /note="Switch II region; other site" /db_xref="CDD:206648" misc_feature 613..624 /gene="Rab40" /note="G4 box; other site" /db_xref="CDD:206648" misc_feature 703..711 /gene="Rab40" /note="G5 box; other site" /db_xref="CDD:206648" misc_feature 796..924 /gene="Rab40" /note="SOCS (suppressors of cytokine signaling) box. The SOCS box is found in the C-terminal region of CIS/SOCS family proteins (in combination with a SH2 domain), ASBs (ankyrin repeat-containing proteins with a SOCS box), SSBs (SPRY domain-containing proteins...; Region: SOCS; cl02533" /db_xref="CDD:470605" misc_feature order(799..816,832..834,853..855,871..873) /gene="Rab40" /note="elongin B/C interaction [active]" /db_xref="CDD:239641" polyA_site 1549 /gene="Rab40" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 accgcccctc gcaagttgta ccatctctat agagatgagc aaaattgcaa ttttcctaaa 61 attcgcaggg gaaaaccaca aataatcagc aacgaaacga aataaatgcg agatagagcc 121 gcgatttgca acaaatgaat cgcggcgact gaaagcgcga aaaacccgcc gaggaaaagt 181 cgccagagcg agggaaatcg ctcatctcta ttacaaatac gaaaatgaaa ttgcgtgcat 241 tctaaatgcc acatgggaac catgaccaag gactacgact atctgctgaa ggttctgctg 301 gtgggcgaca gcgatgtggg caagcacgag atcctctcga acctggagga tccctccacg 361 gagagcccct tttgcagcgg gaacgcctac aagaccacca ccatcctgct ggagggcaag 421 cgggtgaagc tgcagctgtg ggacacctcc ggccagggac gcttctgcac gatcatacgc 481 tcctattcgc gcggcgccca gggcatcatc ctcgtctacg acatcaccaa caagtggagc 541 ttcgacggga tcgatcgctg gctcaaggag gtcgacgagc acgcccctgg catcccgaag 601 gtgcttgtgg ggaatcgcct gcatttggcc ttcaagcgac aggtggcggc caaacaggcc 661 gagacctacg ccagccgcaa caatatgtcc tgcttcgaga tatcgcccct gtgcgacttc 721 aacatccgcg agtccttttg cgagctggca cggatggcgc tgcatcgcaa tggcatggag 781 cacatctggc gcagcaataa ggtgctgacg ctgcaggagc tgtgctgcag gacgatcgtg 841 cggaggacga gcgtgtacgc gatcgattcg ctgccgttgc cgccgtcggt gaagtcgacg 901 ctcaagtcat acgcgctgac cacctcgcag tgcttcaact cactgaccca gagctcaaag 961 agcaagaacc gctgcaagac gccgacgagc ggcagccgga atagctgtgc gatcgcgtga 1021 tcgttgcctt gtaggccgcc gcccagctgc ctacgccgcc acgcccccca accgacatta 1081 actttaattg agctctactt atgtactata ggctaacaca cacaccacac accacacaca 1141 cacacacact acacactcac ccacatggtt attatcttat ttgtttcatc gacattgata 1201 tttgtggcca acaatgttta ctttttacac agtaaagctt acattaattt aattattaac 1261 ccccgtccca ttttccccat tccctctctt ctctcttttg cattactcta atgttgttaa 1321 tattattatg tttgtataat tataatattt aaagcatcaa acacatcaac ataacaaaaa 1381 aaagaaaaaa acaacagcaa gtgaaaatca atttttatat gcataaaaaa attttttttt 1441 gtttggttac catcggttta aaatattctt agagatgtat tgtaattgaa gcgaattcag 1501 caagagaagc gcacacaaag gcgaattgat aaagataatt cataatgaa