Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017149863 1580 bp mRNA linear INV 09-DEC-2024 (Rab40), transcript variant X1, mRNA. ACCESSION XM_017149863 VERSION XM_017149863.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017149863.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1580 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1580 /gene="Rab40" /note="RAS oncogene family member Rab40; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108062967" CDS 254..1051 /gene="Rab40" /codon_start=1 /product="ras-related protein Rab-40C isoform X1" /protein_id="XP_017005352.2" /db_xref="GeneID:108062967" /translation="MGTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGN DCTSHILQTVAYKTTTILLEGKRVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDIT NKWSFDGIDRWLKEVDEHAPGIPKVLVGNRLHLAFKRQVAAKQAETYASRNNMSCFEI SPLCDFNIRESFCELARMALHRNGMEHIWRSNKVLTLQELCCRTIVRRTSVYAIDSLP LPPSVKSTLKSYALTTSQCFNSLTQSSKSKNRCKTPTSGSRNSCAIA" misc_feature 269..805 /gene="Rab40" /note="Members of the P-loop NTPase domain superfamily are characterized by a conserved nucleotide phosphate-binding motif, also referred to as the Walker A motif (GxxxxGK[S/T], where x is any residue), and the Walker B motif (hhhh[D/E], where h is a...; Region: P-loop containing Nucleoside Triphosphate Hydrolases; cl38936" /db_xref="CDD:476819" misc_feature 305..328 /gene="Rab40" /note="G1 box; other site" /db_xref="CDD:206648" misc_feature order(311..331,482..484,644..649,653..655,734..742) /gene="Rab40" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206648" misc_feature 374..376 /gene="Rab40" /note="G2 box; other site" /db_xref="CDD:206648" misc_feature order(386..388,419..424) /gene="Rab40" /note="Switch I region; other site" /db_xref="CDD:206648" misc_feature 473..484 /gene="Rab40" /note="G3 box; other site" /db_xref="CDD:206648" misc_feature order(479..484,530..535) /gene="Rab40" /note="Switch II region; other site" /db_xref="CDD:206648" misc_feature 644..655 /gene="Rab40" /note="G4 box; other site" /db_xref="CDD:206648" misc_feature 734..742 /gene="Rab40" /note="G5 box; other site" /db_xref="CDD:206648" misc_feature 827..955 /gene="Rab40" /note="SOCS (suppressors of cytokine signaling) box. The SOCS box is found in the C-terminal region of CIS/SOCS family proteins (in combination with a SH2 domain), ASBs (ankyrin repeat-containing proteins with a SOCS box), SSBs (SPRY domain-containing proteins...; Region: SOCS; cl02533" /db_xref="CDD:470605" misc_feature order(830..847,863..865,884..886,902..904) /gene="Rab40" /note="elongin B/C interaction [active]" /db_xref="CDD:239641" polyA_site 1580 /gene="Rab40" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaccgcccct cgcaagttgt accatctcta tagagatgag caaaattgca attttcctaa 61 aattcgcagg ggaaaaccac aaataatcag caacgaaacg aaataaatgc gagatagagc 121 cgcgatttgc aacaaatgaa tcgcggcgac tgaaagcgcg aaaaacccgc cgaggaaaag 181 tcgccagagc gagggaaatc gctcatctct attacaaata cgaaaatgaa attgcgtgca 241 ttctaaatgc cacatgggaa ccatgaccaa ggactacgac tatctgctga aggttctgct 301 ggtgggcgac agcgatgtgg gcaagcacga gatcctctcg aacctggagg atccctccac 361 ggagagcccc ttttgcagcg ggaacgactg cacatctcat atcctccaaa cggtagccta 421 caagaccacc accatcctgc tggagggcaa gcgggtgaag ctgcagctgt gggacacctc 481 cggccaggga cgcttctgca cgatcatacg ctcctattcg cgcggcgccc agggcatcat 541 cctcgtctac gacatcacca acaagtggag cttcgacggg atcgatcgct ggctcaagga 601 ggtcgacgag cacgcccctg gcatcccgaa ggtgcttgtg gggaatcgcc tgcatttggc 661 cttcaagcga caggtggcgg ccaaacaggc cgagacctac gccagccgca acaatatgtc 721 ctgcttcgag atatcgcccc tgtgcgactt caacatccgc gagtcctttt gcgagctggc 781 acggatggcg ctgcatcgca atggcatgga gcacatctgg cgcagcaata aggtgctgac 841 gctgcaggag ctgtgctgca ggacgatcgt gcggaggacg agcgtgtacg cgatcgattc 901 gctgccgttg ccgccgtcgg tgaagtcgac gctcaagtca tacgcgctga ccacctcgca 961 gtgcttcaac tcactgaccc agagctcaaa gagcaagaac cgctgcaaga cgccgacgag 1021 cggcagccgg aatagctgtg cgatcgcgtg atcgttgcct tgtaggccgc cgcccagctg 1081 cctacgccgc cacgcccccc aaccgacatt aactttaatt gagctctact tatgtactat 1141 aggctaacac acacaccaca caccacacac acacacacac tacacactca cccacatggt 1201 tattatctta tttgtttcat cgacattgat atttgtggcc aacaatgttt actttttaca 1261 cagtaaagct tacattaatt taattattaa cccccgtccc attttcccca ttccctctct 1321 tctctctttt gcattactct aatgttgtta atattattat gtttgtataa ttataatatt 1381 taaagcatca aacacatcaa cataacaaaa aaaagaaaaa aacaacagca agtgaaaatc 1441 aatttttata tgcataaaaa aatttttttt tgtttggtta ccatcggttt aaaatattct 1501 tagagatgta ttgtaattga agcgaattca gcaagagaag cgcacacaaa ggcgaattga 1561 taaagataat tcataatgaa