Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RAS oncogene family member Rab40


LOCUS       XM_017149863            1580 bp    mRNA    linear   INV 09-DEC-2024
            (Rab40), transcript variant X1, mRNA.
ACCESSION   XM_017149863
VERSION     XM_017149863.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017149863.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1580
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1580
                     /gene="Rab40"
                     /note="RAS oncogene family member Rab40; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108062967"
     CDS             254..1051
                     /gene="Rab40"
                     /codon_start=1
                     /product="ras-related protein Rab-40C isoform X1"
                     /protein_id="XP_017005352.2"
                     /db_xref="GeneID:108062967"
                     /translation="MGTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGN
                     DCTSHILQTVAYKTTTILLEGKRVKLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDIT
                     NKWSFDGIDRWLKEVDEHAPGIPKVLVGNRLHLAFKRQVAAKQAETYASRNNMSCFEI
                     SPLCDFNIRESFCELARMALHRNGMEHIWRSNKVLTLQELCCRTIVRRTSVYAIDSLP
                     LPPSVKSTLKSYALTTSQCFNSLTQSSKSKNRCKTPTSGSRNSCAIA"
     misc_feature    269..805
                     /gene="Rab40"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    305..328
                     /gene="Rab40"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(311..331,482..484,644..649,653..655,734..742)
                     /gene="Rab40"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     misc_feature    374..376
                     /gene="Rab40"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(386..388,419..424)
                     /gene="Rab40"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    473..484
                     /gene="Rab40"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(479..484,530..535)
                     /gene="Rab40"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    644..655
                     /gene="Rab40"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    734..742
                     /gene="Rab40"
                     /note="G5 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    827..955
                     /gene="Rab40"
                     /note="SOCS (suppressors of cytokine signaling) box. The
                     SOCS box is found in the C-terminal region of CIS/SOCS
                     family proteins (in combination with a SH2 domain), ASBs
                     (ankyrin repeat-containing proteins with a SOCS box), SSBs
                     (SPRY domain-containing proteins...; Region: SOCS;
                     cl02533"
                     /db_xref="CDD:470605"
     misc_feature    order(830..847,863..865,884..886,902..904)
                     /gene="Rab40"
                     /note="elongin B/C interaction [active]"
                     /db_xref="CDD:239641"
     polyA_site      1580
                     /gene="Rab40"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaccgcccct cgcaagttgt accatctcta tagagatgag caaaattgca attttcctaa
       61 aattcgcagg ggaaaaccac aaataatcag caacgaaacg aaataaatgc gagatagagc
      121 cgcgatttgc aacaaatgaa tcgcggcgac tgaaagcgcg aaaaacccgc cgaggaaaag
      181 tcgccagagc gagggaaatc gctcatctct attacaaata cgaaaatgaa attgcgtgca
      241 ttctaaatgc cacatgggaa ccatgaccaa ggactacgac tatctgctga aggttctgct
      301 ggtgggcgac agcgatgtgg gcaagcacga gatcctctcg aacctggagg atccctccac
      361 ggagagcccc ttttgcagcg ggaacgactg cacatctcat atcctccaaa cggtagccta
      421 caagaccacc accatcctgc tggagggcaa gcgggtgaag ctgcagctgt gggacacctc
      481 cggccaggga cgcttctgca cgatcatacg ctcctattcg cgcggcgccc agggcatcat
      541 cctcgtctac gacatcacca acaagtggag cttcgacggg atcgatcgct ggctcaagga
      601 ggtcgacgag cacgcccctg gcatcccgaa ggtgcttgtg gggaatcgcc tgcatttggc
      661 cttcaagcga caggtggcgg ccaaacaggc cgagacctac gccagccgca acaatatgtc
      721 ctgcttcgag atatcgcccc tgtgcgactt caacatccgc gagtcctttt gcgagctggc
      781 acggatggcg ctgcatcgca atggcatgga gcacatctgg cgcagcaata aggtgctgac
      841 gctgcaggag ctgtgctgca ggacgatcgt gcggaggacg agcgtgtacg cgatcgattc
      901 gctgccgttg ccgccgtcgg tgaagtcgac gctcaagtca tacgcgctga ccacctcgca
      961 gtgcttcaac tcactgaccc agagctcaaa gagcaagaac cgctgcaaga cgccgacgag
     1021 cggcagccgg aatagctgtg cgatcgcgtg atcgttgcct tgtaggccgc cgcccagctg
     1081 cctacgccgc cacgcccccc aaccgacatt aactttaatt gagctctact tatgtactat
     1141 aggctaacac acacaccaca caccacacac acacacacac tacacactca cccacatggt
     1201 tattatctta tttgtttcat cgacattgat atttgtggcc aacaatgttt actttttaca
     1261 cagtaaagct tacattaatt taattattaa cccccgtccc attttcccca ttccctctct
     1321 tctctctttt gcattactct aatgttgtta atattattat gtttgtataa ttataatatt
     1381 taaagcatca aacacatcaa cataacaaaa aaaagaaaaa aacaacagca agtgaaaatc
     1441 aatttttata tgcataaaaa aatttttttt tgtttggtta ccatcggttt aaaatattct
     1501 tagagatgta ttgtaattga agcgaattca gcaagagaag cgcacacaaa ggcgaattga
     1561 taaagataat tcataatgaa