Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii small bristles (sbr), mRNA.


LOCUS       XM_017146798            2988 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017146798
VERSION     XM_017146798.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017146798.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2988
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2988
                     /gene="sbr"
                     /note="small bristles; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108060878"
     CDS             517..2580
                     /gene="sbr"
                     /codon_start=1
                     /product="nuclear RNA export factor 1"
                     /protein_id="XP_017002287.3"
                     /db_xref="GeneID:108060878"
                     /translation="MPKRGGGGGGGRGGGDGGGQRYNNNVGNGGGRYSALEDFDEVED
                     RQRRKDRNKRRVSFKPSQFPHNKKDIKLRPEDLRRWDEDDDMSDMTTTVKQDRPTSRR
                     RGSPIPRGKFGKLMPNSFGWYQVTLQNAQIYEKETLLRALLAAMSPHVFIPQYWRAER
                     NCVIFFTDDYEVAERIQHLGRHAQLPDGYRLMPRVRSGIPLVAIDDAFKEKMKVTMAK
                     RYNVQTKALDLSRFHADPELKLIFCPLFRQNVMSAAIDIICDNIPDLEAINLNDNSMT
                     SMEAFKGVEKRIPNLKILYLGDNKIPSLAHLVVFRNLSILELVLKNNPCRSRYKDSQH
                     FISEVRRKFPKLLKLDGEALAPQVTFDLTEQGRILETKASFLCDNAGAEVVRQFLDQY
                     FRIFDSESRQSLLDAYHENAMLSITMPSANQAGRLNSFWKFNRNLRRLVNGEDNRTRH
                     LKYGRLACVSTLDEWPRTLHERRTFTVDLTIFNTSMMVFTVTGLFKELNGEASASGSM
                     SMQYELRHFARTYVVVPQNTGYCIRNETIFITNASQEQVREFKRSQHQPAPGSMASTS
                     TSATATSPQQQQPGTTGGLQGRLNPVGVATGPVAILPGNPLAATSPVNSGSAALSVGA
                     VAPGVQDENTKMQMIQAMSAQSQMNVLWSRKCLEETNWDYNHAAFVFEQLFKENKIPP
                     EAFVK"
     misc_feature    880..1116
                     /gene="sbr"
                     /note="Tap, RNA-binding; Region: Tap-RNA_bind; pfam09162"
                     /db_xref="CDD:462696"
     misc_feature    1186..1308
                     /gene="sbr"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275382"
     misc_feature    <1297..>1488
                     /gene="sbr"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:443914"
     misc_feature    1309..1386
                     /gene="sbr"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275382"
     misc_feature    1387..1458
                     /gene="sbr"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275382"
     misc_feature    1459..1551
                     /gene="sbr"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275382"
     misc_feature    1657..2139
                     /gene="sbr"
                     /note="Nuclear transport factor 2 (NTF2) domain plays an
                     important role in the trafficking of macromolecules, ions
                     and small molecules between the cytoplasm and nucleus.
                     This bi-directional transport of macromolecules across the
                     nuclear envelope requires many...; Region: NTF2; cd00780"
                     /db_xref="CDD:238403"
     misc_feature    order(1741..1743,1759..1761,1873..1875,1948..1950,
                     1954..1959,1984..1986,2086..2088,2116..2124,2128..2130,
                     2134..2136)
                     /gene="sbr"
                     /note="TAP/p15 interaction [active]"
                     /db_xref="CDD:238403"
     misc_feature    order(1753..1755,1759..1764,1939..1944,1948..1950,
                     1954..1959,1978..1980,1990..1998,2008..2010,2014..2022,
                     2059..2061,2068..2070,2086..2088,2116..2124,2128..2139)
                     /gene="sbr"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238403"
     misc_feature    order(1762..1767,1909..1911,1924..1926,1993..1995,
                     1999..2001,2005..2010,2014..2016,2059..2061,2125..2127,
                     2131..2133,2137..2139)
                     /gene="sbr"
                     /note="RanGDP-NTF2 interaction [active]"
                     /db_xref="CDD:238403"
     misc_feature    2386..2574
                     /gene="sbr"
                     /note="C-terminal domain of vertebrate Tap protein;
                     Region: TAP_C; smart00804"
                     /db_xref="CDD:197882"
     misc_feature    order(2458..2460,2470..2472,2479..2484,2488..2499,
                     2512..2514,2524..2526,2536..2538,2551..2553,2557..2559)
                     /gene="sbr"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:270527"
     polyA_site      2988
                     /gene="sbr"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgataggccg ttccgaaaga accgaaggga aaacaacact caacaataat ccttggaaca
       61 ctgaatttta cctgttcctt tttgttttcc tgcttcgttg ccttcgcaaa actacctttt
      121 tttccgggaa cagcagccgg gaaaactcgg aaatcctccg tcaatttgtg caaaaaccat
      181 cgggccgtgt ctatcgaaag cggatcgctc gtcactagag tcactaaaat aagtgtttaa
      241 tttcataaaa ttgcgttgta tgtggattgt tgagaccagg caaagcgaat tattccaacg
      301 agtatataaa gtgtgaggaa ctccagcgta tttcgcaaag cattctcggc actttgtgcg
      361 ttttgcattt tttgcgcaaa aaaaaacaca agataggctg attttcacaa caacaaaaac
      421 aaagaacgat agtgcaaaaa acgtgctgaa gaaagcattt ttttttctac ccatccgttg
      481 ttgttgcctc ataaatttgt aaggaaaaat cggaaaatgc ccaaacgcgg tggcggcggc
      541 ggcggcggaa gaggcggcgg cgacggcggt ggccagcggt acaacaacaa cgtcggcaat
      601 ggcggcggac gttactcggc gctcgaggat ttcgatgaag tggaggatcg tcagcgacgc
      661 aaggatcgta acaaacggcg cgtcagcttt aagccctcgc agtttccgca caacaaaaag
      721 gacatcaagc tgcgtcccga ggatctgcgc cgctgggacg aggatgatga catgagcgac
      781 atgaccacaa ccgtcaagca ggatagaccc acctcccgac gacgaggatc gcccattccg
      841 cgcggcaagt tcggcaaact gatgcccaac agctttggct ggtaccaagt gacgctacaa
      901 aatgcacaga tttacgaaaa ggaaaccctt ttgcgggcct tattggcggc aatgtcgccg
      961 catgtcttca taccgcaata ttggcgagcg gaacgcaatt gcgtgatctt cttcaccgac
     1021 gactacgagg tggccgagcg cattcaacat ctgggcaggc acgcccagct acccgatggc
     1081 tataggctga tgccgcgcgt gcgcagcggc attccgctgg tggccatcga cgatgccttc
     1141 aaggagaaga tgaaggtgac catggccaag cggtacaatg tgcagaccaa ggcactcgac
     1201 ctctcccgct tccatgccga tccggagctc aagctgatct tttgcccgct cttccggcag
     1261 aacgtgatga gcgccgccat cgatattatc tgcgataata tacccgatct ggaggcgatc
     1321 aacctgaatg acaacagcat gaccagcatg gaggccttca agggcgtgga gaagcggata
     1381 ccgaacctca agatactcta tttgggggat aataagatac catcactggc ccacctggtg
     1441 gtgtttcgca acctgtctat tttggagctg gtcttaaaga acaatccctg ccgttcccgc
     1501 tacaaggact cgcagcactt tatcagcgaa gtacgtcgca agttccccaa actgctgaag
     1561 ttggatggag aggccctggc gccgcaggtc acctttgatc taaccgagca gggacgcatt
     1621 ctcgagacga aggcctcctt cctgtgcgac aacgctggcg ccgaggtggt gcgtcagttc
     1681 ctggaccagt acttccgcat ttttgattcg gagagccgac agtccctgct ggatgcctac
     1741 cacgaaaacg cgatgctgtc cataacgatg ccgtcggcca atcaggcggg aaggctgaac
     1801 agcttctgga agttcaatcg caacctgcga cgcctggtga acggcgaaga caaccgcacg
     1861 cggcacttga agtacggacg gctggcctgc gtttccacgt tggacgagtg gccaaggacg
     1921 ctgcacgagc gtcgcacctt caccgtcgac ctgaccatat tcaatacttc catgatggta
     1981 ttcacggtga cgggattgtt caaggagctg aacggcgagg ccagcgcctc cggctcgatg
     2041 tcgatgcagt acgagctgcg ccactttgcc cgcacctacg tggtggtgcc gcagaacacc
     2101 ggctattgca tccgcaacga gaccatcttc atcacgaacg cctcgcagga gcaggtgcgt
     2161 gagttcaagc ggtcgcagca ccagccggct cccggttcca tggccagcac atcgacaagt
     2221 gccacggcga ccagtccgca gcagcagcag ccagggacga ctgggggtct gcagggtcgt
     2281 ctcaatccgg tgggcgtggc aaccgggccg gtggccattc tgccaggaaa tccgctggca
     2341 gccacctcac cggtgaacag cggcagtgcc gccttatcag tgggtgcagt ggcgcctggc
     2401 gtgcaggatg agaacaccaa aatgcagatg atacaggcga tgagtgcgca aagccaaatg
     2461 aacgtgctct ggagtcgcaa atgcttggag gagacgaatt gggactataa ccatgccgca
     2521 ttcgttttcg agcaactctt caaggaaaac aaaattccgc ccgaggcttt tgtcaagtaa
     2581 ttctcattcg acatttgacc agaagcagca agggggaaaa acagagcaga gccaagtgcc
     2641 acgtatacag aatcaaatgt tttgtttatt tgttttcgtt ttgtaattaa atacttttta
     2701 atattttttt ttagagtcac atctaaattg taataaaacg ctgagttagt tgtgcgcaca
     2761 ttgtcgagcc acaatgatcg cagccccttg ataggtatat ttaactcgct ttaagttccg
     2821 tccgcagatc ccctggacca agacccttct ggcttgagcg ccaggacgaa gagtctgcga
     2881 acggttgccc cctttagaat ttagaactgt tttatagccc taagcacgta caagaaaata
     2941 tacatcaaaa tcctgtatgc aacaatgttg ttgaaaataa cgcaaaaa