Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017146728 926 bp mRNA linear INV 09-DEC-2024 methyltransferase NEP1 (LOC108060834), mRNA. ACCESSION XM_017146728 VERSION XM_017146728.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017146728.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..926 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..926 /gene="LOC108060834" /note="ribosomal RNA small subunit methyltransferase NEP1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108060834" CDS 72..830 /gene="LOC108060834" /codon_start=1 /product="ribosomal RNA small subunit methyltransferase NEP1" /protein_id="XP_017002217.2" /db_xref="GeneID:108060834" /translation="MGGQGKTINRKRKFVGRKADDPEFDLDKKQFKVLHLNATEKRLI IVLEGAQLETVKVHNTFELLNCDDHAGIMRKNQRDPGSCRPDITHQCLLMLFDSPLNR AGLLQVFVRTEHNVLIEINPQTRIPRTFKRFAGLMVQLLHKFQIRANDSSRRLMSVIK NPITDHVPVGCKKYAMSFSGKLVANCRDLVPHGEEGSEKYDEPVVIVIGAFAHGVLKT DYTEELFSISNYPLSAAIACSKLCSAFEEVWGVV" misc_feature 198..809 /gene="LOC108060834" /note="18S rRNA (pseudouridine(1248)-N1)-methyltransferase Nep1; Region: Nep1-like; cd18088" /db_xref="CDD:349961" misc_feature order(270..275,321..323,327..329,339..341,348..353, 360..362,366..368,465..467,624..626,753..755,759..761, 765..770,774..779,786..791,798..800) /gene="LOC108060834" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:349961" misc_feature order(597..605,693..698,702..707,711..713,744..755, 759..767,771..773,780..782) /gene="LOC108060834" /note="SAM binding site [chemical binding]; other site" /db_xref="CDD:349961" polyA_site 926 /gene="LOC108060834" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtcatactga aactgctttt cgaaaaaacg tgcggatttc taggtgatat atttggattc 61 tataatatat catgggtggc cagggcaaga ccatcaacag gaagcgcaag tttgtgggcc 121 gcaaggcgga cgatccggag ttcgatctgg acaagaagca gttcaaggtg ctccatctga 181 atgccaccga aaagcggctg ataatcgttt tggagggagc ccaactggag acggtgaagg 241 tacacaacac cttcgagctg ctcaattgcg acgatcatgc ggggataatg cgcaaaaacc 301 aaagggatcc cggctcctgt cgcccggaca tcacccacca gtgcctcttg atgctcttcg 361 actcgcccct gaaccgcgcc ggtctgctgc aggtcttcgt gcgcacggag cacaatgtgc 421 tgatcgaaat caatccgcag acccgcattc ccaggacctt caagagattc gctggtctga 481 tggtccaact gctgcacaag ttccagattc gcgccaatga ctcctcccgc cgactgatga 541 gtgtgatcaa gaatcccatt acggatcacg tgccagtcgg ctgcaagaag tacgccatga 601 gcttctccgg caaactggtg gccaattgcc gggatctggt gccgcatggc gaggagggca 661 gcgaaaagta cgacgaaccc gtggtcattg tcatcggagc ctttgcccac ggcgtcctca 721 agacggacta caccgaggag ctgttctcca tcagcaacta ccccctgtcg gcggccatcg 781 cgtgctccaa actctgctcc gccttcgagg aggtgtgggg cgtggtctag gcccgctgat 841 tattgtccta tagtttagtc atagctagta gttagtctac catatattct ttaaattggt 901 ttatataaaa ttttgtggaa ttttaa