Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ribosomal RNA small subunit


LOCUS       XM_017146728             926 bp    mRNA    linear   INV 09-DEC-2024
            methyltransferase NEP1 (LOC108060834), mRNA.
ACCESSION   XM_017146728
VERSION     XM_017146728.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017146728.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..926
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..926
                     /gene="LOC108060834"
                     /note="ribosomal RNA small subunit methyltransferase NEP1;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 2 Proteins"
                     /db_xref="GeneID:108060834"
     CDS             72..830
                     /gene="LOC108060834"
                     /codon_start=1
                     /product="ribosomal RNA small subunit methyltransferase
                     NEP1"
                     /protein_id="XP_017002217.2"
                     /db_xref="GeneID:108060834"
                     /translation="MGGQGKTINRKRKFVGRKADDPEFDLDKKQFKVLHLNATEKRLI
                     IVLEGAQLETVKVHNTFELLNCDDHAGIMRKNQRDPGSCRPDITHQCLLMLFDSPLNR
                     AGLLQVFVRTEHNVLIEINPQTRIPRTFKRFAGLMVQLLHKFQIRANDSSRRLMSVIK
                     NPITDHVPVGCKKYAMSFSGKLVANCRDLVPHGEEGSEKYDEPVVIVIGAFAHGVLKT
                     DYTEELFSISNYPLSAAIACSKLCSAFEEVWGVV"
     misc_feature    198..809
                     /gene="LOC108060834"
                     /note="18S rRNA (pseudouridine(1248)-N1)-methyltransferase
                     Nep1; Region: Nep1-like; cd18088"
                     /db_xref="CDD:349961"
     misc_feature    order(270..275,321..323,327..329,339..341,348..353,
                     360..362,366..368,465..467,624..626,753..755,759..761,
                     765..770,774..779,786..791,798..800)
                     /gene="LOC108060834"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:349961"
     misc_feature    order(597..605,693..698,702..707,711..713,744..755,
                     759..767,771..773,780..782)
                     /gene="LOC108060834"
                     /note="SAM binding site [chemical binding]; other site"
                     /db_xref="CDD:349961"
     polyA_site      926
                     /gene="LOC108060834"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtcatactga aactgctttt cgaaaaaacg tgcggatttc taggtgatat atttggattc
       61 tataatatat catgggtggc cagggcaaga ccatcaacag gaagcgcaag tttgtgggcc
      121 gcaaggcgga cgatccggag ttcgatctgg acaagaagca gttcaaggtg ctccatctga
      181 atgccaccga aaagcggctg ataatcgttt tggagggagc ccaactggag acggtgaagg
      241 tacacaacac cttcgagctg ctcaattgcg acgatcatgc ggggataatg cgcaaaaacc
      301 aaagggatcc cggctcctgt cgcccggaca tcacccacca gtgcctcttg atgctcttcg
      361 actcgcccct gaaccgcgcc ggtctgctgc aggtcttcgt gcgcacggag cacaatgtgc
      421 tgatcgaaat caatccgcag acccgcattc ccaggacctt caagagattc gctggtctga
      481 tggtccaact gctgcacaag ttccagattc gcgccaatga ctcctcccgc cgactgatga
      541 gtgtgatcaa gaatcccatt acggatcacg tgccagtcgg ctgcaagaag tacgccatga
      601 gcttctccgg caaactggtg gccaattgcc gggatctggt gccgcatggc gaggagggca
      661 gcgaaaagta cgacgaaccc gtggtcattg tcatcggagc ctttgcccac ggcgtcctca
      721 agacggacta caccgaggag ctgttctcca tcagcaacta ccccctgtcg gcggccatcg
      781 cgtgctccaa actctgctcc gccttcgagg aggtgtgggg cgtggtctag gcccgctgat
      841 tattgtccta tagtttagtc atagctagta gttagtctac catatattct ttaaattggt
      901 ttatataaaa ttttgtggaa ttttaa