Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Sirtuin 4 (Sirt4), transcript


LOCUS       XM_017143074            1088 bp    mRNA    linear   INV 09-DEC-2024
            variant X1, mRNA.
ACCESSION   XM_017143074
VERSION     XM_017143074.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143074.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1088
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1088
                     /gene="Sirt4"
                     /note="Sirtuin 4; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 4 Proteins"
                     /db_xref="GeneID:108058381"
     CDS             83..1021
                     /gene="Sirt4"
                     /codon_start=1
                     /product="NAD-dependent protein deacylase Sirt4"
                     /protein_id="XP_016998563.1"
                     /db_xref="GeneID:108058381"
                     /translation="MRVGQLLRFRSTAFRGSTARQEYVPHHKPVVEDDIKRLEDFLMS
                     KPNVLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHMEFVKSSAVRKRYWARNFV
                     GWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHSKAGSRNVVEVHGSGYVVKC
                     LSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYIENFQIPECTQCGGDL
                     KPEIVFFGDSVPRSRLDEIAGMVYNSDGLLVLGSSLLVFSGYRVVLQTKDLKLPVAIV
                     NIGDTRADHLADIKISAKCGDVIPKLFDFRSSKRAS"
     misc_feature    194..979
                     /gene="Sirt4"
                     /note="Eukaryotic and prokaryotic group (class2) which
                     includes human sirtuin SIRT4 and several bacterial
                     homologs; and are members of the SIR2 family of proteins,
                     silent information regulator 2 (Sir2) enzymes which
                     catalyze NAD+-dependent protein/histone...; Region: SIRT4;
                     cd01409"
                     /db_xref="CDD:238700"
     misc_feature    order(245..247,251..256,275..280,428..430,482..487,
                     491..493,536..538,833..835,848..850,914..919,974..976)
                     /gene="Sirt4"
                     /note="NAD+ binding site [chemical binding]; other site"
                     /db_xref="CDD:238700"
     misc_feature    order(488..490,536..538,749..751,755..769,845..853)
                     /gene="Sirt4"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238700"
     misc_feature    order(560..562,569..571,713..715,722..724)
                     /gene="Sirt4"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:238700"
     polyA_site      1088
                     /gene="Sirt4"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gatactatcg ttagtggctg gcccagctct agtaacgtaa tcagtaaaat aaattttaat
       61 aataaaacaa tacataacaa atatgcgggt gggtcaactg ctccggttcc gaagcaccgc
      121 cttccggggc tccaccgcta ggcaagagta cgtgccacat cataaacccg tcgtggagga
      181 tgacatcaaa cggttggaag acttcctgat gtccaaaccg aatgttttgg ttctgacagg
      241 tgctgggatc tcaactgaat cgggaattcc cgactaccgc tccgagggcg tgggactcta
      301 cgcccgttcc aatcacaagc ccgtgcagca catggagttc gtcaagtcgt cggcggtgcg
      361 caagcgctac tgggccagga acttcgtggg ctggcccaag ttctccgcca ctcagcccaa
      421 tgccacgcat catgctctgg ccagattcga gcgggaggag cgagtgcagg cggtggtcac
      481 ccagaatgtg gatcgtctgc actcgaaggc cggcagccgc aatgtggtcg aggtccatgg
      541 cagtggctat gtggtcaagt gcttatcctg cgaataccgc atcgatcgtc atgagttcca
      601 gagcatcctg gcctccctca atccggcctt caaggacgcc cccgacatga tccggcccga
      661 cggcgatgtg gagatccccc tggagtatat agagaacttc cagatccctg agtgcacgca
      721 gtgtggtggc gacttgaagc ccgaaattgt cttcttcggg gactctgtac cgagatcccg
      781 actggatgaa atcgcaggca tggtctacaa tagcgatggc ctgttggtcc tgggctccag
      841 tctcttggtc ttctccggct accgcgttgt cctgcagaca aaggacctca agctaccggt
      901 ggccatagtc aatataggcg acacgcgtgc cgaccacctg gcggacatca agatatccgc
      961 caagtgcggc gatgtgatac caaaattgtt cgattttcgc tcctcgaaac gcgccagcta
     1021 gtcctggctc ctccttgttg tatatatgta tgtatacttt caaataaaat tcagttataa
     1081 ttgaacaa