Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017141496 911 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017141496 VERSION XM_017141496.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017141496.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..911 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..911 /gene="l(1)G0004" /note="lethal (1) G0004; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:108057296" CDS 127..840 /gene="l(1)G0004" /codon_start=1 /product="RNA-binding protein pno1" /protein_id="XP_016996985.2" /db_xref="GeneID:108057296" /translation="MEAENIKADAFEPAKRAAKRGATSGDVEMQVDEATGIEGQSLGT SRGSAPPKAKRARSELRKVSVPPHRYSSLKEHWMKIFTPVVEHMKLQIRFNMKARQVE LRVGPETPDIANLQRGADFVRAFLCGFEVDDALALLRLEDLFVESFEIKDVKTLRGDH QSRAIGRLAGKGGRTKFTIENVTKTRIVLADSKIHILGSYQNIQLARRAVCNLILGSP PSKVYGNLRAVASRLSERM" misc_feature 301..537 /gene="l(1)G0004" /note="first type I K homology (KH) RNA-binding domain found in partner of NOB1 (PNO1) and similar proteins; Region: KH-I_PNO1_rpt1; cd22391" /db_xref="CDD:411819" misc_feature order(301..303,307..312,334..339,343..348,355..357, 367..369,379..381,385..387,391..417,430..432,436..438, 448..450,460..465,472..474,484..486,514..516,520..525, 529..534) /gene="l(1)G0004" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:411819" misc_feature order(325..342,412..414,421..423) /gene="l(1)G0004" /note="RNA binding site [nucleotide binding]; other site" /db_xref="CDD:411819" misc_feature 541..828 /gene="l(1)G0004" /note="second type I K homology (KH) RNA-binding domain found in partner of NOB1 (PNO1) and similar proteins; Region: KH-I_PNO1_rpt2; cd22392" /db_xref="CDD:411820" misc_feature order(541..558,562..567,580..591,610..615,640..642, 646..648,655..657,664..669,676..684,715..717,724..726, 745..747,757..762,769..771,826..828) /gene="l(1)G0004" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:411820" misc_feature order(604..606,610..615,619..627,631..645,649..657, 691..693,736..738,772..783,787..789,793..795,805..807) /gene="l(1)G0004" /note="RNA binding site [nucleotide binding]; other site" /db_xref="CDD:411820" polyA_site 911 /gene="l(1)G0004" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgactcaaat cgataaccga tagcctggga gcaacaataa tatcgcgagc acgtggaaat 61 aaatatagcg ctgaataaca acacaaaacg caaattgcga gaaatacaga gccaggacaa 121 cccaaaatgg aggcagagaa catcaaggcg gacgcattcg agccggcgaa gagggcggcc 181 aagcgcgggg ccaccagtgg cgacgtggag atgcaggtgg acgaggcgac cggaatcgag 241 ggtcagtcac tgggaacctc gcgaggatca gcccctccaa aggccaaacg ggcccgtagc 301 gagctgcgca aggtgtcggt gccgccgcac aggtactctt cgctgaagga gcactggatg 361 aagatcttca cgcccgtcgt ggagcacatg aagctgcaga tccgcttcaa catgaaggcg 421 cgccaggtgg agttgcgcgt gggtccggag acgccggata tagctaatct ccagcgtggc 481 gccgactttg tgcgcgcctt tctctgcggc ttcgaggtgg acgatgctct ggcgctgctc 541 cggctggagg atctgttcgt agagtcattc gaaattaagg atgtgaagac gctgcgcggt 601 gaccaccagt caagggccat tggtcggctg gccggcaagg gcggacgcac caagttcacc 661 atcgagaacg tgaccaagac ccgcatcgtg ctggccgaca gcaagatcca catcctcggc 721 agctaccaga acatccagct ggctcgccgg gcggtctgca atctgatcct gggatcgccg 781 cccagcaagg tgtacggcaa tttgcgggcc gtcgcctcgc gcctctcgga gcgcatgtga 841 ttgagtagct ttttcttttt ctcttttttt ttagcattag caataaataa taaatataac 901 ttgtattcat a