Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii lethal (1) G0004 (l(1)G0004),


LOCUS       XM_017141496             911 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017141496
VERSION     XM_017141496.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141496.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..911
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..911
                     /gene="l(1)G0004"
                     /note="lethal (1) G0004; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:108057296"
     CDS             127..840
                     /gene="l(1)G0004"
                     /codon_start=1
                     /product="RNA-binding protein pno1"
                     /protein_id="XP_016996985.2"
                     /db_xref="GeneID:108057296"
                     /translation="MEAENIKADAFEPAKRAAKRGATSGDVEMQVDEATGIEGQSLGT
                     SRGSAPPKAKRARSELRKVSVPPHRYSSLKEHWMKIFTPVVEHMKLQIRFNMKARQVE
                     LRVGPETPDIANLQRGADFVRAFLCGFEVDDALALLRLEDLFVESFEIKDVKTLRGDH
                     QSRAIGRLAGKGGRTKFTIENVTKTRIVLADSKIHILGSYQNIQLARRAVCNLILGSP
                     PSKVYGNLRAVASRLSERM"
     misc_feature    301..537
                     /gene="l(1)G0004"
                     /note="first type I K homology (KH) RNA-binding domain
                     found in partner of NOB1 (PNO1) and similar proteins;
                     Region: KH-I_PNO1_rpt1; cd22391"
                     /db_xref="CDD:411819"
     misc_feature    order(301..303,307..312,334..339,343..348,355..357,
                     367..369,379..381,385..387,391..417,430..432,436..438,
                     448..450,460..465,472..474,484..486,514..516,520..525,
                     529..534)
                     /gene="l(1)G0004"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:411819"
     misc_feature    order(325..342,412..414,421..423)
                     /gene="l(1)G0004"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:411819"
     misc_feature    541..828
                     /gene="l(1)G0004"
                     /note="second type I K homology (KH) RNA-binding domain
                     found in partner of NOB1 (PNO1) and similar proteins;
                     Region: KH-I_PNO1_rpt2; cd22392"
                     /db_xref="CDD:411820"
     misc_feature    order(541..558,562..567,580..591,610..615,640..642,
                     646..648,655..657,664..669,676..684,715..717,724..726,
                     745..747,757..762,769..771,826..828)
                     /gene="l(1)G0004"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:411820"
     misc_feature    order(604..606,610..615,619..627,631..645,649..657,
                     691..693,736..738,772..783,787..789,793..795,805..807)
                     /gene="l(1)G0004"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:411820"
     polyA_site      911
                     /gene="l(1)G0004"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgactcaaat cgataaccga tagcctggga gcaacaataa tatcgcgagc acgtggaaat
       61 aaatatagcg ctgaataaca acacaaaacg caaattgcga gaaatacaga gccaggacaa
      121 cccaaaatgg aggcagagaa catcaaggcg gacgcattcg agccggcgaa gagggcggcc
      181 aagcgcgggg ccaccagtgg cgacgtggag atgcaggtgg acgaggcgac cggaatcgag
      241 ggtcagtcac tgggaacctc gcgaggatca gcccctccaa aggccaaacg ggcccgtagc
      301 gagctgcgca aggtgtcggt gccgccgcac aggtactctt cgctgaagga gcactggatg
      361 aagatcttca cgcccgtcgt ggagcacatg aagctgcaga tccgcttcaa catgaaggcg
      421 cgccaggtgg agttgcgcgt gggtccggag acgccggata tagctaatct ccagcgtggc
      481 gccgactttg tgcgcgcctt tctctgcggc ttcgaggtgg acgatgctct ggcgctgctc
      541 cggctggagg atctgttcgt agagtcattc gaaattaagg atgtgaagac gctgcgcggt
      601 gaccaccagt caagggccat tggtcggctg gccggcaagg gcggacgcac caagttcacc
      661 atcgagaacg tgaccaagac ccgcatcgtg ctggccgaca gcaagatcca catcctcggc
      721 agctaccaga acatccagct ggctcgccgg gcggtctgca atctgatcct gggatcgccg
      781 cccagcaagg tgtacggcaa tttgcgggcc gtcgcctcgc gcctctcgga gcgcatgtga
      841 ttgagtagct ttttcttttt ctcttttttt ttagcattag caataaataa taaatataac
      901 ttgtattcat a