Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RAS oncogene family member Rab39


LOCUS       XM_017138889            1371 bp    mRNA    linear   INV 09-DEC-2024
            (Rab39), mRNA.
ACCESSION   XM_017138889
VERSION     XM_017138889.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017138889.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1371
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1371
                     /gene="Rab39"
                     /note="RAS oncogene family member Rab39; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108055521"
     CDS             322..978
                     /gene="Rab39"
                     /codon_start=1
                     /product="ras-related protein rab-39"
                     /protein_id="XP_016994378.1"
                     /db_xref="GeneID:108055521"
                     /translation="MVEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGV
                     DFFARLIEMKDGTQIKLQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIP
                     LWMMEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTEEAQKFAKQHGLHFVETSARS
                     GANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSGFSRPNSLDFNLVVAEPEKSSCC
                     "
     misc_feature    343..975
                     /gene="Rab39"
                     /note="Rab GTPase family 39 (Rab39); Region: Rab39;
                     cd04111"
                     /db_xref="CDD:133311"
     misc_feature    349..354
                     /gene="Rab39"
                     /note="Rab subfamily motif 1 (RabSF1); other site"
                     /db_xref="CDD:133311"
     misc_feature    367..390
                     /gene="Rab39"
                     /note="G1 box; other site"
                     /db_xref="CDD:133311"
     misc_feature    order(373..393,421..423,439..444,523..525,691..696,
                     700..702,790..798)
                     /gene="Rab39"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133311"
     misc_feature    order(391..426,436..441)
                     /gene="Rab39"
                     /note="Rab subfamily motif 2 (RabSF2); other site"
                     /db_xref="CDD:133311"
     misc_feature    order(421..423,436..462)
                     /gene="Rab39"
                     /note="Switch I region; other site"
                     /db_xref="CDD:133311"
     misc_feature    order(436..438,448..471,493..495,499..501)
                     /gene="Rab39"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133311"
     misc_feature    442..444
                     /gene="Rab39"
                     /note="G2 box; other site"
                     /db_xref="CDD:133311"
     misc_feature    order(445..447,451..459,505..507,511..513,532..537,
                     544..546,556..558,562..573,844..846)
                     /gene="Rab39"
                     /note="putative effector interaction site [active]"
                     /db_xref="CDD:133311"
     misc_feature    order(445..450,454..456,511..516,535..537,541..543,
                     547..555)
                     /gene="Rab39"
                     /note="putative GDI interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133311"
     misc_feature    445..459
                     /gene="Rab39"
                     /note="Rab family motif 1 (RabF1); other site"
                     /db_xref="CDD:133311"
     misc_feature    499..513
                     /gene="Rab39"
                     /note="Rab family motif 2 (RabF2); other site"
                     /db_xref="CDD:133311"
     misc_feature    514..525
                     /gene="Rab39"
                     /note="G3 box; other site"
                     /db_xref="CDD:133311"
     misc_feature    order(523..525,529..561)
                     /gene="Rab39"
                     /note="Switch II region; other site"
                     /db_xref="CDD:133311"
     misc_feature    532..549
                     /gene="Rab39"
                     /note="Rab family motif 3 (RabF3); other site"
                     /db_xref="CDD:133311"
     misc_feature    556..570
                     /gene="Rab39"
                     /note="Rab family motif 4 (RabF4); other site"
                     /db_xref="CDD:133311"
     misc_feature    583..600
                     /gene="Rab39"
                     /note="Rab family motif 5 (RabF5); other site"
                     /db_xref="CDD:133311"
     misc_feature    670..684
                     /gene="Rab39"
                     /note="Rab subfamily motif 3 (RabSF3); other site"
                     /db_xref="CDD:133311"
     misc_feature    691..702
                     /gene="Rab39"
                     /note="G4 box; other site"
                     /db_xref="CDD:133311"
     misc_feature    790..798
                     /gene="Rab39"
                     /note="G5 box; other site"
                     /db_xref="CDD:133311"
     misc_feature    838..846
                     /gene="Rab39"
                     /note="Rab subfamily motif 4 (RabSF4); other site"
                     /db_xref="CDD:133311"
     misc_feature    967..975
                     /gene="Rab39"
                     /note="putative lipid modification site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133311"
     polyA_site      1371
                     /gene="Rab39"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acacacacgc acgcacacac tcacgggctg gcatgagaaa aaaacacaaa acaaaacaaa
       61 attcagaggc agctgaattc gaattctcga atatttataa tttaacaacc accgccgacg
      121 gccgggaatc gagcgtcgcg cagccaggaa tccagggagc ccgacaaacc atcaaattgc
      181 ttcggaaacc cagaaaaccc aagcagcagc agcaaaacag cgatttgcgt ctcaaagttt
      241 gcgagagaca ggtggaaatt gagatacttt gcggactcac agataaatcc gtgaatttcg
      301 ccgcaaagac gacatttcgc catggtggag cccattttcg agtatcagtt tcgactgatt
      361 ttaatcggcg acagcaccgt gggcaaaagt tcgctgctca agttcttcac agacggcaaa
      421 ttcgccgagt tgtctgatcc cacggtgggc gtcgacttct tcgcccgcct gatcgagatg
      481 aaggacggca cacagatcaa gctgcagctg tgggacaccg ccgggcagga gcgcttccgg
      541 tcgatcacca agtcctacta ccgcaactcg gtgggcgtgc tgctcgtcta cgacatatcg
      601 aatcacgcca gcttcgagca cataccgctg tggatgatgg aggcgcagcg gcacatcgag
      661 ccccaccgcc ccgttttcgc tttggtcggc tgcaagctgg acctgatcaa cgcgggcggc
      721 caccgcgagg tgaccaccga ggaggcgcaa aagtttgcca aacagcacgg cctgcatttc
      781 gtggagacgt cggcccgttc cggtgcgaat gtggaggagg ccttccgcat ggtcacccag
      841 gaggtctacg cccgcatccg gtcgggcgag tacaaggcag aggacggctg ggatgggatc
      901 aagtccggtt tctcgcggcc caatagtctc gacttcaatc tcgtcgtcgc cgagccggag
      961 aagtcatcct gttgttgatt acctacccca catcttttat tattttttca atactgtttg
     1021 tgtacattga tttgtatcgt acccctcctt tttcccccct gaaaaactac tttgttgact
     1081 cttttaatct tgtttaatcg cctagttaag ctggaaaacc aaaacagtta cgtatatttg
     1141 tacaatgcgt ttttttttct aattaccttt agtttcgctc ttaagttaac ttttagttag
     1201 gtgactcacg gaaattagtg gtttgtttcg tcccaattat tcgagaaata cgtagcgtag
     1261 agtttctgtg ctcctaactc atacaacaca taactccaca tacacaaatg cgaacggaaa
     1321 agctatacat atacttgaaa cttgaaatat aaacgttttt attaatacga a