Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017138889 1371 bp mRNA linear INV 09-DEC-2024 (Rab39), mRNA. ACCESSION XM_017138889 VERSION XM_017138889.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017138889.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1371 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1371 /gene="Rab39" /note="RAS oncogene family member Rab39; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108055521" CDS 322..978 /gene="Rab39" /codon_start=1 /product="ras-related protein rab-39" /protein_id="XP_016994378.1" /db_xref="GeneID:108055521" /translation="MVEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGV DFFARLIEMKDGTQIKLQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIP LWMMEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTEEAQKFAKQHGLHFVETSARS GANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSGFSRPNSLDFNLVVAEPEKSSCC " misc_feature 343..975 /gene="Rab39" /note="Rab GTPase family 39 (Rab39); Region: Rab39; cd04111" /db_xref="CDD:133311" misc_feature 349..354 /gene="Rab39" /note="Rab subfamily motif 1 (RabSF1); other site" /db_xref="CDD:133311" misc_feature 367..390 /gene="Rab39" /note="G1 box; other site" /db_xref="CDD:133311" misc_feature order(373..393,421..423,439..444,523..525,691..696, 700..702,790..798) /gene="Rab39" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:133311" misc_feature order(391..426,436..441) /gene="Rab39" /note="Rab subfamily motif 2 (RabSF2); other site" /db_xref="CDD:133311" misc_feature order(421..423,436..462) /gene="Rab39" /note="Switch I region; other site" /db_xref="CDD:133311" misc_feature order(436..438,448..471,493..495,499..501) /gene="Rab39" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:133311" misc_feature 442..444 /gene="Rab39" /note="G2 box; other site" /db_xref="CDD:133311" misc_feature order(445..447,451..459,505..507,511..513,532..537, 544..546,556..558,562..573,844..846) /gene="Rab39" /note="putative effector interaction site [active]" /db_xref="CDD:133311" misc_feature order(445..450,454..456,511..516,535..537,541..543, 547..555) /gene="Rab39" /note="putative GDI interaction site [polypeptide binding]; other site" /db_xref="CDD:133311" misc_feature 445..459 /gene="Rab39" /note="Rab family motif 1 (RabF1); other site" /db_xref="CDD:133311" misc_feature 499..513 /gene="Rab39" /note="Rab family motif 2 (RabF2); other site" /db_xref="CDD:133311" misc_feature 514..525 /gene="Rab39" /note="G3 box; other site" /db_xref="CDD:133311" misc_feature order(523..525,529..561) /gene="Rab39" /note="Switch II region; other site" /db_xref="CDD:133311" misc_feature 532..549 /gene="Rab39" /note="Rab family motif 3 (RabF3); other site" /db_xref="CDD:133311" misc_feature 556..570 /gene="Rab39" /note="Rab family motif 4 (RabF4); other site" /db_xref="CDD:133311" misc_feature 583..600 /gene="Rab39" /note="Rab family motif 5 (RabF5); other site" /db_xref="CDD:133311" misc_feature 670..684 /gene="Rab39" /note="Rab subfamily motif 3 (RabSF3); other site" /db_xref="CDD:133311" misc_feature 691..702 /gene="Rab39" /note="G4 box; other site" /db_xref="CDD:133311" misc_feature 790..798 /gene="Rab39" /note="G5 box; other site" /db_xref="CDD:133311" misc_feature 838..846 /gene="Rab39" /note="Rab subfamily motif 4 (RabSF4); other site" /db_xref="CDD:133311" misc_feature 967..975 /gene="Rab39" /note="putative lipid modification site [posttranslational modification]; other site" /db_xref="CDD:133311" polyA_site 1371 /gene="Rab39" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acacacacgc acgcacacac tcacgggctg gcatgagaaa aaaacacaaa acaaaacaaa 61 attcagaggc agctgaattc gaattctcga atatttataa tttaacaacc accgccgacg 121 gccgggaatc gagcgtcgcg cagccaggaa tccagggagc ccgacaaacc atcaaattgc 181 ttcggaaacc cagaaaaccc aagcagcagc agcaaaacag cgatttgcgt ctcaaagttt 241 gcgagagaca ggtggaaatt gagatacttt gcggactcac agataaatcc gtgaatttcg 301 ccgcaaagac gacatttcgc catggtggag cccattttcg agtatcagtt tcgactgatt 361 ttaatcggcg acagcaccgt gggcaaaagt tcgctgctca agttcttcac agacggcaaa 421 ttcgccgagt tgtctgatcc cacggtgggc gtcgacttct tcgcccgcct gatcgagatg 481 aaggacggca cacagatcaa gctgcagctg tgggacaccg ccgggcagga gcgcttccgg 541 tcgatcacca agtcctacta ccgcaactcg gtgggcgtgc tgctcgtcta cgacatatcg 601 aatcacgcca gcttcgagca cataccgctg tggatgatgg aggcgcagcg gcacatcgag 661 ccccaccgcc ccgttttcgc tttggtcggc tgcaagctgg acctgatcaa cgcgggcggc 721 caccgcgagg tgaccaccga ggaggcgcaa aagtttgcca aacagcacgg cctgcatttc 781 gtggagacgt cggcccgttc cggtgcgaat gtggaggagg ccttccgcat ggtcacccag 841 gaggtctacg cccgcatccg gtcgggcgag tacaaggcag aggacggctg ggatgggatc 901 aagtccggtt tctcgcggcc caatagtctc gacttcaatc tcgtcgtcgc cgagccggag 961 aagtcatcct gttgttgatt acctacccca catcttttat tattttttca atactgtttg 1021 tgtacattga tttgtatcgt acccctcctt tttcccccct gaaaaactac tttgttgact 1081 cttttaatct tgtttaatcg cctagttaag ctggaaaacc aaaacagtta cgtatatttg 1141 tacaatgcgt ttttttttct aattaccttt agtttcgctc ttaagttaac ttttagttag 1201 gtgactcacg gaaattagtg gtttgtttcg tcccaattat tcgagaaata cgtagcgtag 1261 agtttctgtg ctcctaactc atacaacaca taactccaca tacacaaatg cgaacggaaa 1321 agctatacat atacttgaaa cttgaaatat aaacgttttt attaatacga a