Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137845 1148 bp mRNA linear INV 09-DEC-2024 (dmrt11E), mRNA. ACCESSION XM_017137845 VERSION XM_017137845.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; corrected model. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137845.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 2 indels ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 JARPSC010000001.1 12066457-12066507 52-84 JARPSC010000001.1 12066915-12066947 85-189 JARPSC010000001.1 12066950-12067054 190-754 JARPSC010000001.1 12067057-12067621 755-1148 JARPSC010000001.1 12068873-12069266 FEATURES Location/Qualifiers source 1..1148 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1148 /gene="dmrt11E" /note="doublesex-Mab related 11E; The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: deleted 4 bases in 2 codons; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108054777" CDS 1..1083 /gene="dmrt11E" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 4 bases in 2 codons" /codon_start=1 /product="LOW QUALITY PROTEIN: doublesex- and mab-3-related transcription factor 1" /protein_id="XP_016993334.3" /db_xref="GeneID:108054777" /translation="MHFHQSQSPNKDVRMGRSQRLAANGRRGDADTNPDPSDARMLRV CTSDPLGDRDHLTLPDCLTAATSSQCLNVRAPVRSLLVDQRVRMSKDTSVTVTRICQR ERRLLRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQ QTMEALEATTSSSGSKHPVNGTTSGSEGEDSLASSSPPPPPSAHPQSPASVTNSSSSS SATRQALMAQKRIYKQRLRSLQQSTLHITAAMEEYKQRFPTFSSPLMERMRKRRAFAD PELNHVMEATLGGNALYFATVAAAVHQEHLYHPMPPTITPSVPPTFSPDDQMMRNTSG TASISSISEKKPKLSFSIESIMGIST" misc_feature 322..462 /gene="dmrt11E" /note="DM DNA binding domain; Region: DM; pfam00751" /db_xref="CDD:459924" ORIGIN 1 atgcactttc accaaagtca gagtccaaac aaagatgtgc ggatgggaag gagccagcga 61 ttagcagcca atggcaggcg aggtgatgcc gataccaatc ccgatccctc agatgctcgg 121 atgctacgtg tgtgtacctc ggatcccctg ggagaccgag accacttgac gctgccagac 181 tgtctgacgg cggcgacaag tagccagtgt ttaaatgttc gcgccccggt ccgcagcctt 241 ttagtcgatc agcgagtcag gatgagcaag gacacgagtg ttacagttac taggatttgc 301 cagcgggagc gacgtcttct gaggacgccc aaatgcgcca ggtgccgcaa ccacggggtc 361 atctcctgtg tcaaaggtca caagcgactg tgccgctggc gcgagtgctg ctgccccaac 421 tgccaactgg tcgtcgatcg ccagcgggtg atggccgccc aggtggccct gcgccgccag 481 cagacgatgg aggccctgga ggccaccacc tcctcctcag gatcgaagca cccggtgaat 541 ggcacgacct ccggcagcga gggcgaggat tccctagcct cctcttcacc accaccacct 601 ccgtcggctc atccacaatc cccagcatct gtgaccaact cctcctcctc atcatccgcc 661 acccgacagg ccctgatggc ccagaagagg atctacaagc agagattacg cagtctgcag 721 cagtccacgc tccatatcac agctgccatg gaagagtaca agcagcgatt tcccacgttc 781 agttcgccgc tgatggagcg catgcgcaaa cgacgggcgt tcgccgatcc ggaactgaac 841 cacgtcatgg aggcgacgct gggcgggaac gctttgtact ttgccaccgt tgccgccgcc 901 gtccaccagg agcacctata tcacccaatg ccgccgacga taacgccctc tgttccgccc 961 accttcagtc ctgatgatca gatgatgagg aacacctcgg gaacagcctc catctcctcg 1021 atctccgaaa agaagcccaa gctgagcttc tccatcgagt ccatcatggg catcagcacg 1081 tagtccccat ccaaaatact ctctgtacat agccctagaa ttagacgatc tttttttgac 1141 tagacata