Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Cathepsin B (CtsB), mRNA.


LOCUS       XM_017137624            1425 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017137624
VERSION     XM_017137624.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017137624.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1425
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1425
                     /gene="CtsB"
                     /note="Cathepsin B; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 20 Proteins"
                     /db_xref="GeneID:108054582"
     CDS             221..1243
                     /gene="CtsB"
                     /codon_start=1
                     /product="cathepsin B"
                     /protein_id="XP_016993113.2"
                     /db_xref="GeneID:108054582"
                     /translation="MKLLLLVATAASVAALCAGEPSLLSDEFIEVVRSKAKTWTVGRN
                     FDASVTEEHIRRLMGVHPDAHKFALAEKREVLGELYTAVDGDLPEEFDARKQWPNCPT
                     IGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFGCNGGF
                     PGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGGTPKCQHVCQ
                     SSYTVDYAKDKHFGSKSYSVKRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQHE
                     HGKELGGHAIRILGWGVWGDEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIESSIS
                     AGLPKL"
     misc_feature    290..412
                     /gene="CtsB"
                     /note="Peptidase family C1 propeptide; Region:
                     Propeptide_C1; pfam08127"
                     /db_xref="CDD:462365"
     misc_feature    482..1228
                     /gene="CtsB"
                     /note="Cathepsin B group; composed of cathepsin B and
                     similar proteins, including tubulointerstitial nephritis
                     antigen (TIN-Ag). Cathepsin B is a lysosomal papain-like
                     cysteine peptidase which is expressed in all tissues and
                     functions primarily as an...; Region:
                     Peptidase_C1A_CathepsinB; cd02620"
                     /db_xref="CDD:239111"
     misc_feature    order(545..547,563..565,1070..1072,1136..1138)
                     /gene="CtsB"
                     /note="active site"
                     /db_xref="CDD:239111"
     misc_feature    order(698..703,992..994,1064..1066,1073..1075,1214..1216)
                     /gene="CtsB"
                     /note="S2 subsite [active]"
                     /db_xref="CDD:239111"
     polyA_site      1425
                     /gene="CtsB"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcagcgggcg ccaaccattt ttttttgtag gaaaacaaga gaaataaaga gcgttctccg
       61 tccgcttttc actggcagta cgaaaacaac gacggagcag agaacagaaa aaaaagaacc
      121 agaacagaag ccacataatc cgaggcgtca ttttccacca ttttatttga gtgattcgtg
      181 tgatttctgc tgtgtcagct gaataaattt caattgcaag atgaagctgc tgctcctggt
      241 ggccaccgcg gcctccgtgg cggcactctg cgccggagaa ccgtcgctgc tatccgatga
      301 gttcatcgag gtggtgcgca gtaaggccaa aacctggacg gttgggcgca atttcgatgc
      361 ctccgtgacg gaggagcaca tccgccgcct gatgggcgtc catccggatg cgcacaagtt
      421 cgcgttggcc gaaaagcgag aggttctggg cgagctctat accgccgtgg atggggatct
      481 tcccgaggag ttcgacgccc ggaagcagtg gccaaactgc ccgaccatcg gcgagatccg
      541 cgaccaggga tcctgcggct cctgctgggc cttcggagcc gtggaagcca tgtccgatcg
      601 ggtgtgcatc cattccggcg gcaaggtgaa cttccacttc tcggccgacg atctggtgtc
      661 ctgctgccac acctgcggct tcggctgcaa cggcggcttc cccggcgccg cctggagcta
      721 ctggacgcgc aagggcatcg tcagcggagg accctacgga tccaatcagg gctgccgtcc
      781 gtacgagatt tcgccctgcg agcaccacgt gaacggaacc cgtccgccct gcgcccatgg
      841 cggtggaacg cccaagtgcc agcacgtctg ccagagcagc tacacggtgg actatgccaa
      901 ggacaagcac ttcggctcca agtcgtattc ggtgaagcgc aatgtgcgcg agatccagga
      961 ggagatcatg acgaatggac ccgtcgaggg tgccttcacc gtctacgagg atctcatttt
     1021 gtacaaggat ggagtctatc agcatgagca cggcaaggag ctgggcggcc atgccattcg
     1081 catcctcggc tggggcgttt ggggcgatga gaagatcccc tactggctca tcggcaactc
     1141 gtggaacacc gactggggcg atcatggctt cttccgcatc ctgcgtggcc aggatcactg
     1201 cggcatcgag agctccattt cggcgggtct gcccaagctg taggatgtat ttgtatgatg
     1261 attatgatga tgtgtatggc ggaaggccgc tggctgatat atcaaccctc tattttctat
     1321 cgcctcctct tatttccatt cccgttcgcg ttcgcaaatg acgtttgtag ttaatgtaaa
     1381 caacaaaacc tgattgataa taaagtattg tacatgactg tggaa