Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017137624 1425 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017137624 VERSION XM_017137624.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017137624.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1425 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1425 /gene="CtsB" /note="Cathepsin B; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 20 Proteins" /db_xref="GeneID:108054582" CDS 221..1243 /gene="CtsB" /codon_start=1 /product="cathepsin B" /protein_id="XP_016993113.2" /db_xref="GeneID:108054582" /translation="MKLLLLVATAASVAALCAGEPSLLSDEFIEVVRSKAKTWTVGRN FDASVTEEHIRRLMGVHPDAHKFALAEKREVLGELYTAVDGDLPEEFDARKQWPNCPT IGEIRDQGSCGSCWAFGAVEAMSDRVCIHSGGKVNFHFSADDLVSCCHTCGFGCNGGF PGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGGTPKCQHVCQ SSYTVDYAKDKHFGSKSYSVKRNVREIQEEIMTNGPVEGAFTVYEDLILYKDGVYQHE HGKELGGHAIRILGWGVWGDEKIPYWLIGNSWNTDWGDHGFFRILRGQDHCGIESSIS AGLPKL" misc_feature 290..412 /gene="CtsB" /note="Peptidase family C1 propeptide; Region: Propeptide_C1; pfam08127" /db_xref="CDD:462365" misc_feature 482..1228 /gene="CtsB" /note="Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag). Cathepsin B is a lysosomal papain-like cysteine peptidase which is expressed in all tissues and functions primarily as an...; Region: Peptidase_C1A_CathepsinB; cd02620" /db_xref="CDD:239111" misc_feature order(545..547,563..565,1070..1072,1136..1138) /gene="CtsB" /note="active site" /db_xref="CDD:239111" misc_feature order(698..703,992..994,1064..1066,1073..1075,1214..1216) /gene="CtsB" /note="S2 subsite [active]" /db_xref="CDD:239111" polyA_site 1425 /gene="CtsB" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcagcgggcg ccaaccattt ttttttgtag gaaaacaaga gaaataaaga gcgttctccg 61 tccgcttttc actggcagta cgaaaacaac gacggagcag agaacagaaa aaaaagaacc 121 agaacagaag ccacataatc cgaggcgtca ttttccacca ttttatttga gtgattcgtg 181 tgatttctgc tgtgtcagct gaataaattt caattgcaag atgaagctgc tgctcctggt 241 ggccaccgcg gcctccgtgg cggcactctg cgccggagaa ccgtcgctgc tatccgatga 301 gttcatcgag gtggtgcgca gtaaggccaa aacctggacg gttgggcgca atttcgatgc 361 ctccgtgacg gaggagcaca tccgccgcct gatgggcgtc catccggatg cgcacaagtt 421 cgcgttggcc gaaaagcgag aggttctggg cgagctctat accgccgtgg atggggatct 481 tcccgaggag ttcgacgccc ggaagcagtg gccaaactgc ccgaccatcg gcgagatccg 541 cgaccaggga tcctgcggct cctgctgggc cttcggagcc gtggaagcca tgtccgatcg 601 ggtgtgcatc cattccggcg gcaaggtgaa cttccacttc tcggccgacg atctggtgtc 661 ctgctgccac acctgcggct tcggctgcaa cggcggcttc cccggcgccg cctggagcta 721 ctggacgcgc aagggcatcg tcagcggagg accctacgga tccaatcagg gctgccgtcc 781 gtacgagatt tcgccctgcg agcaccacgt gaacggaacc cgtccgccct gcgcccatgg 841 cggtggaacg cccaagtgcc agcacgtctg ccagagcagc tacacggtgg actatgccaa 901 ggacaagcac ttcggctcca agtcgtattc ggtgaagcgc aatgtgcgcg agatccagga 961 ggagatcatg acgaatggac ccgtcgaggg tgccttcacc gtctacgagg atctcatttt 1021 gtacaaggat ggagtctatc agcatgagca cggcaaggag ctgggcggcc atgccattcg 1081 catcctcggc tggggcgttt ggggcgatga gaagatcccc tactggctca tcggcaactc 1141 gtggaacacc gactggggcg atcatggctt cttccgcatc ctgcgtggcc aggatcactg 1201 cggcatcgag agctccattt cggcgggtct gcccaagctg taggatgtat ttgtatgatg 1261 attatgatga tgtgtatggc ggaaggccgc tggctgatat atcaaccctc tattttctat 1321 cgcctcctct tatttccatt cccgttcgcg ttcgcaaatg acgtttgtag ttaatgtaaa 1381 caacaaaacc tgattgataa taaagtattg tacatgactg tggaa