Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans exosome complex component RRP4


LOCUS       XM_013255296            1106 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089445), mRNA.
ACCESSION   XM_013255296
VERSION     XM_013255296.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255296.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1106
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1106
                     /gene="LOC106089445"
                     /note="exosome complex component RRP4; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 8 Proteins"
                     /db_xref="GeneID:106089445"
     CDS             97..993
                     /gene="LOC106089445"
                     /codon_start=1
                     /product="exosome complex component RRP4"
                     /protein_id="XP_013110750.1"
                     /db_xref="GeneID:106089445"
                     /translation="MTTNVNIRLALDRVNMGLLAQNQANAPRLYTPGEVVTAQQGFMK
                     GHGTYVEGDDIKASVAGVMEQVNKLVSIKPLKSRYVGEIGDVVVARITEVQQKRWKVN
                     TNSRLDSVLLLSSVNLPGGELRRRVAEDEQAMRKYLQEGDLISAEVQNIYDEGTLSLY
                     TRSLKYGKLSQGVLVKVFPSLVKRRKTHFHNLPCGASIILGNNGFIWISPSASGTGEV
                     GDGGFSQNLSEVIPRADREVIARLRNCILALAHCKMMLYDTSISYAYEESMKYDVHEL
                     LQQEAIFDVAFLTQHRLRLQEE"
     misc_feature    181..294
                     /gene="LOC106089445"
                     /note="Exosome complex exonuclease RRP4 N-terminal region;
                     Region: ECR1_N; pfam14382"
                     /db_xref="CDD:464162"
     misc_feature    328..603
                     /gene="LOC106089445"
                     /note="Rrp4 S1-like RNA-binding domain. S1-like
                     RNA-binding domains are found in a wide variety of
                     RNA-associated proteins. Rrp4 protein is a subunit of the
                     exosome complex. The exosome plays a central role in 3' to
                     5' RNA processing and degradation in...; Region: S1_Rrp4;
                     cd05789"
                     /db_xref="CDD:240215"
     misc_feature    order(328..330,364..366,370..372,412..414)
                     /gene="LOC106089445"
                     /note="subunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240215"
     misc_feature    order(370..372,394..396,424..426,430..432)
                     /gene="LOC106089445"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240215"
     misc_feature    610..966
                     /gene="LOC106089445"
                     /note="type I K homology (KH) RNA-binding domain found in
                     exosome complex component Rrp4 from eukaryote; Region:
                     KH-I_Rrp4_eukar; cd22525"
                     /db_xref="CDD:411953"
     misc_feature    order(610..612,637..639,646..648,652..657,661..663,
                     715..717,793..795,802..804,811..816,823..828,850..855,
                     913..918,964..966)
                     /gene="LOC106089445"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:411953"
     polyA_site      1106
                     /gene="LOC106089445"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acttttattg agtgggaaat tcatcagtct gtttttcagc gtgtttttgt ttacattttt
       61 atttctacat aaatttgata atttttgtta ataaaaatga ccaccaacgt taatatacgc
      121 ctggctttgg atcgcgtaaa catgggattg ttggcccaaa atcaggccaa tgctccaaga
      181 ctgtatacac ccggcgaagt ggtcaccgca cagcaaggct tcatgaaagg ccatggcaca
      241 tatgtggagg gtgatgatat caaagcctct gtggccggtg ttatggaaca agtcaataaa
      301 ttggtctcca ttaaacctct caaaagtcgt tatgttggcg aaattggtga tgtggttgtc
      361 gcacgcataa ccgaagtgca acaaaagcgt tggaaggtta acaccaactc tagattggat
      421 tcagtgctgt tactctcctc agtgaatttg cctggaggcg agttgagaag acgtgtggct
      481 gaggatgagc aggccatgag aaaatatcta caagaaggtg atcttatatc ggcagaggtg
      541 caaaatatct acgacgaggg taccttatcg ttgtatactc gctccctgaa gtatggcaaa
      601 ttgtcacaag gggtgttggt gaaggtgttt ccctcattgg taaaacggcg aaagacacat
      661 ttccataatt tgccttgtgg cgccagcatt atattgggca acaatggttt catttggata
      721 tctccctctg caagcggcac tggcgaagtt ggtgatggtg gtttctccca gaatttatcc
      781 gaagtaatac ctagagccga tcgtgaagtt atagcccgtc taagaaactg cattttggca
      841 ttggcccatt gtaaaatgat gctgtatgac accagtatat catatgccta tgaggagtcc
      901 atgaaatatg atgtacacga attgttacaa caagaggcca tatttgatgt ggcattttta
      961 acacagcatc gtttacgact gcaggaggag taagccgaaa tgatataacc tgaatgttta
     1021 tcgtagattt taagttgagt acctattttt tgtaaattga atttgcaatg acagactgat
     1081 gaataaacta aaagggaaaa ggaaaa