Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255296 1106 bp mRNA linear INV 02-SEP-2023 (LOC106089445), mRNA. ACCESSION XM_013255296 VERSION XM_013255296.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255296.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1106 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1106 /gene="LOC106089445" /note="exosome complex component RRP4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:106089445" CDS 97..993 /gene="LOC106089445" /codon_start=1 /product="exosome complex component RRP4" /protein_id="XP_013110750.1" /db_xref="GeneID:106089445" /translation="MTTNVNIRLALDRVNMGLLAQNQANAPRLYTPGEVVTAQQGFMK GHGTYVEGDDIKASVAGVMEQVNKLVSIKPLKSRYVGEIGDVVVARITEVQQKRWKVN TNSRLDSVLLLSSVNLPGGELRRRVAEDEQAMRKYLQEGDLISAEVQNIYDEGTLSLY TRSLKYGKLSQGVLVKVFPSLVKRRKTHFHNLPCGASIILGNNGFIWISPSASGTGEV GDGGFSQNLSEVIPRADREVIARLRNCILALAHCKMMLYDTSISYAYEESMKYDVHEL LQQEAIFDVAFLTQHRLRLQEE" misc_feature 181..294 /gene="LOC106089445" /note="Exosome complex exonuclease RRP4 N-terminal region; Region: ECR1_N; pfam14382" /db_xref="CDD:464162" misc_feature 328..603 /gene="LOC106089445" /note="Rrp4 S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Rrp4 protein is a subunit of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in...; Region: S1_Rrp4; cd05789" /db_xref="CDD:240215" misc_feature order(328..330,364..366,370..372,412..414) /gene="LOC106089445" /note="subunit interface [polypeptide binding]; other site" /db_xref="CDD:240215" misc_feature order(370..372,394..396,424..426,430..432) /gene="LOC106089445" /note="RNA binding site [nucleotide binding]; other site" /db_xref="CDD:240215" misc_feature 610..966 /gene="LOC106089445" /note="type I K homology (KH) RNA-binding domain found in exosome complex component Rrp4 from eukaryote; Region: KH-I_Rrp4_eukar; cd22525" /db_xref="CDD:411953" misc_feature order(610..612,637..639,646..648,652..657,661..663, 715..717,793..795,802..804,811..816,823..828,850..855, 913..918,964..966) /gene="LOC106089445" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:411953" polyA_site 1106 /gene="LOC106089445" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acttttattg agtgggaaat tcatcagtct gtttttcagc gtgtttttgt ttacattttt 61 atttctacat aaatttgata atttttgtta ataaaaatga ccaccaacgt taatatacgc 121 ctggctttgg atcgcgtaaa catgggattg ttggcccaaa atcaggccaa tgctccaaga 181 ctgtatacac ccggcgaagt ggtcaccgca cagcaaggct tcatgaaagg ccatggcaca 241 tatgtggagg gtgatgatat caaagcctct gtggccggtg ttatggaaca agtcaataaa 301 ttggtctcca ttaaacctct caaaagtcgt tatgttggcg aaattggtga tgtggttgtc 361 gcacgcataa ccgaagtgca acaaaagcgt tggaaggtta acaccaactc tagattggat 421 tcagtgctgt tactctcctc agtgaatttg cctggaggcg agttgagaag acgtgtggct 481 gaggatgagc aggccatgag aaaatatcta caagaaggtg atcttatatc ggcagaggtg 541 caaaatatct acgacgaggg taccttatcg ttgtatactc gctccctgaa gtatggcaaa 601 ttgtcacaag gggtgttggt gaaggtgttt ccctcattgg taaaacggcg aaagacacat 661 ttccataatt tgccttgtgg cgccagcatt atattgggca acaatggttt catttggata 721 tctccctctg caagcggcac tggcgaagtt ggtgatggtg gtttctccca gaatttatcc 781 gaagtaatac ctagagccga tcgtgaagtt atagcccgtc taagaaactg cattttggca 841 ttggcccatt gtaaaatgat gctgtatgac accagtatat catatgccta tgaggagtcc 901 atgaaatatg atgtacacga attgttacaa caagaggcca tatttgatgt ggcattttta 961 acacagcatc gtttacgact gcaggaggag taagccgaaa tgatataacc tgaatgttta 1021 tcgtagattt taagttgagt acctattttt tgtaaattga atttgcaatg acagactgat 1081 gaataaacta aaagggaaaa ggaaaa