Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster cubilin (Cubn), partial mRNA.


LOCUS       NM_167193              11349 bp    mRNA    linear   INV 26-DEC-2023
ACCESSION   NM_167193
VERSION     NM_167193.2
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 11349)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 11349)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 11349)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 11349)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 11349)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 11349)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 11349)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 11349)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 11349)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 11349)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 11349)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 11349)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 11349)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 11349)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 11349)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 11349)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 11349)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 11349)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 11349)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 11349)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 11349)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 11349)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 11349)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            On Jan 26, 2009 this sequence version replaced NM_167193.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..11349
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            <1..11349
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="Cubilin"
                     /map="8E7-8E10"
                     /db_xref="FLYBASE:FBgn0052702"
                     /db_xref="GeneID:326235"
     CDS             1..11253
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CG32702 gene product from transcript CG32702-RB;
                     CG32702-PB; Cubn-PB; dCubilin; TMPRSS6 iron sensing;
                     cubilin ortholog"
                     /codon_start=1
                     /product="cubilin"
                     /protein_id="NP_727348.2"
                     /db_xref="FLYBASE:FBpp0271945"
                     /db_xref="GeneID:326235"
                     /db_xref="FLYBASE:FBgn0052702"
                     /translation="MEGAARSRLLLCWTLLAIITDTWPIAEGFVNSPKIISKDGNLIF
                     ESGANRNISFRLSGNSRLTINEELDVMELLLATSGSKKRSGGKDDDFVDARELADQLA
                     DFNRRAFGANGLSAMLRVQQNRTRGSMALLRRFQTRLRALENRVDRMKTDLEANSCAS
                     GPCENGGTCYNTYTGFRCQCRSAFEGTKCEMDVNECALYEGTDLGCQNGGQCQNHFGT
                     YSCLCQPGWHGMHCTQRKADCSQSSAWELCGHGSCVPSADDAGYRCICEPGWKTNGLT
                     PICGEDVDECSDSAAHKPCSTSCINLPGSFTCAPCPAGLTGNGVSCRDLDECQTNNGG
                     CSLSPKVDCINTYGSYHCGECPVGWTGDGRKCERSPQDIDIPAGQTPRTCPAGNNPCY
                     PTASCFLISGTTSCRCPMGMVGTGYGPNGCVNGTTTNCKENPCLNGGICLFAGPSNYT
                     CLCPIGFRPPICEPQPSPCDQHPCKNGGRCRPTTSGDLFVCQCLPGYRGRLCETRFSS
                     CNGMLSAQSGRLRYPPEGTGYEHNAQCAWVIRTNESLVVNVTFNSFDVEDSTECRFDW
                     LQINDGRSAAAQIIGRYCGNHLPHGGNIVSSGNQLYLWFRSDNSTAKEGFDLTWNSME
                     PQCGGRLNFETHGTLASPGSPGNYPKNRDCRWQLVAPTTKRIKLTFFSLQLEQHANCN
                     FDYVLIKDSISGRELAKYCTTGAPAPLLLPTHLAEIHFHSDAEGSDTGFQLHYSVEER
                     VPGCGGVYTAKEGTISESSTANTEPGGVSCEYEIHLAVGEQVVIQFARLELDPLDCLE
                     VLDITDEGGSILQEKICGSDASRLNPPTFTSEFNRLKIKFYARAGSFQLNYRMACDYK
                     LNNEQGTITSPGYPNLTRSDRICTYTISTATNTVISLKRIDFQLTNGESDDDDNDECL
                     TTNLRINDGLNRKILGPYCGKNQPEENFVSETNYLQLHLSTDVDSMGRGFKFEYRALA
                     TGNDKCGGVHTRSGDHIRLPVHDDSYAGEATCYWVIMAPANKAIRLHWNSFSLENAVD
                     CIYDYLEIYDSLGAQVNDERSKPLAKYCGNSVPEDLLSHSRQLVLKFVSDYSESDGGF
                     DLTYTFEDRAKCGGHIHASSGELTSPEYPANYSAGLDCDWHLTGTIDHLLEIQVENFE
                     LEQSPNCSADYLEVRNGGGTDSPLIGRFCGRDIPARIPGFSHEMRLILHTDSAINGRG
                     FRLRWRIFAFGCGGSLRSNMGAISSPRYPNSYPNMAHCEWRISLHPGSGISLLIEDLE
                     LEGLSNCYYDSVKIYTGIKLPNQSPCKVLCKDDDLHNPLIQLENNKGTIVFDSDASNT
                     FRGFRISYKANCIRNLTATTGTIESLNYMEPFWETIPINCSWTIRAPKGNRVLVEVSH
                     LARHEQHVPTATMPGGLYIVDGRNVQEIVTPQAMNISGEVLTVVHNASNVNFQLDYRI
                     DGCMEELRGTFGFFQSPNYPKMYPNNLECYWLITVEQDSAIELTINNIDLEDSPNCTK
                     DALTVSNHKNSVEVHERHCGSTTKLVITSSGHRLHVRFISDNSHNGLGFEATYRTVKA
                     TCGGKLTARNGVIESPNYPLNYPAHSRCEWQVEVSQHHQIVFEMADLNLESGYDCNWD
                     YLEAYDLTEDDTEGERLFKVCGDETEDDKLLSSSSNMAVVRFISDDSVSKKGFRLHFH
                     ESCGQTIIVDETMFDYIQMSRQAARNESCLWVFQAVEPNKRIIFTPTHVKLREDANQQ
                     YPTEGDCLNVGVKIYEGTEPQGTPRLKFCRSHPPALISNGQALTVSVPLQLVEEFQGH
                     YMTMDTSCGSIYNALSGKFTSPYYPASYPPNIECLWLLEASMGNSLSLTLESMDLEKS
                     ESCNRDYLEVREESESGQLIGVYCGNEVPGVIHSRGAIWMKFKSDDDNVGEGFMASYN
                     YEHHNELNGTEGTIESPHFPSKFQDPVPYSWRITVDKEYVVAISLLYLRDLDQPHLNF
                     YDGYSDIGARIEVTDPDETIISSTNVVYFTSNRGPFKLNWNRLSKEALRSNRTAEERT
                     RQCGNQLITIDRSVIGFHSPGYPNGYEQDLNCFWTLVPSNPAMHAVLTLSQIDLEIFS
                     EDCIADYVKIFSGSDLQNWSELRTLCSLPTESSDRVFHGRPYLRVEFVTDPSVNKTGF
                     NGIVRTACGSEITASKGLVNITEILKVLPRPNHDCVWTIKVRQGRRIKIDFPDFQLQN
                     NMASGSSDCRNYLLLRNGNDEDSPFLGRGKYCEDVVHEVLNTSSNKAYIKFHFASPPR
                     FLVSFRFEELRYTDSGRIRLSASGDEQFISSPYYPHLPHPHSECIWIVEAPPEHRIML
                     HFQGAFDMLDATGEPEECQREFVLINDGSTELRPEIGRYCGNRKPDTIYSTGNQMRIR
                     YFTDVSEPHMGFNASLSVARCGGSFHSPEGVIASPSRDLLLIHEEGKQLQECVYTIEL
                     EKGSTIDLTSEYLQIPTLRNGSCSQRNHLMLEEMDAFGLDGEEKIVDTLMLCGMEAKH
                     LISETNKIVFRYRFLDGIPAENQGFRLKYTSLGSRCGETIYASVGVLQTPGYPLGVPH
                     PMHCKWQVQVPKGRRVRLEILDFNTGTNMDLRGRLGFRGRLTVANDFKMQSILGRYNV
                     DPPAEVLSSDNTMGIDAFLLPIVQNHGIKLRFSAYGSSSCPGFTVMMNEVADIQFQRF
                     NISRPLHCSYKVVPPSNSTLLIRVKEYNTTSVMMWNTHMCALLSPLKFNRLEQEEELM
                     ERILCDYQSPAPGKPLPSIRLPFPIQLVVSASARNAMTNLVLSYSTQSCGGVIILEPG
                     DNMTVHQPSGMVSAAGAIDCAWAIGPYTDASGEDEVLVPQDIQLEVSVYNVNLPAPSP
                     SAQSPEAPCLHHYLKVYNGPDQNSPSLGLFCNQATAVNMVVERGLFLEYHSDSFSANA
                     TFNVSIKYGSGCGGKLVYPYRAIDFAEQYKNNVECIWEVEATMGYHIGLTFQGRFYIE
                     DSPGCTKDYLLVQQRNETTGNWTDLQRICGRVAPEMINTTSPYLRLIFRSDGDVVADG
                     FLAKFERNCGGLLYADSTEQELASPGFPNGYEKYLQCNWTIVPRSPSMGGVLVSFVNF
                     DLEQGPISVCLYDNLTVTTKDKGKDPQQTTLCGVKHNHEYRGKEYVNLLLRTDGSYSG
                     RGFTLLYTSRLCGGIISRTSMVESPVQHTDNTLPPGSDCYWNLTAPAGYKFNIKFLFI
                     DFEANSNCAYDGVEVFSGPIPDERYRWGRFCGRINEDLPLISIPQERGIIHSFSDDRD
                     PSRGFRALVRVMPNCDEKISLNGSSRYVYSKFNNAGGYQNDLDCQIVFRVNPDQQISV
                     EFSNFHVQDTDGCRSDYVELRDGGGTFADIIGRFCGQNQPPTLRTTRHTLYMRFVTDN
                     KVTDTGFQVTINAIPRLCGSSEITLSADGTKEVTINSPARTPGGNYPNGVSCFWKIKG
                     DSLLRVQFVNFDLHGPNQNGSCVDDYLKIYNSEDAPLLEQGLGTDLVFNGQTSSKNGF
                     GFATEHVYCGNVKPDIYYGRSSEVYLKFRSKGLEQHGGFQLQVALNSNRERHYDGLQG
                     RVHLSQSADCNIIIRAPPNYTLSLYYTELIFGTYDCEMENLEVFDRTNRSLQRVCSFV
                     DMGKSLFSNANELRLQMKTGSYLTSLDLTYLASPVEKGPGCGGQFYNTEGIFSNPFYP
                     NNVRNNSECQWIVRVPSNNVVFLTFEVFNLGSKTTCHTDYLQILEQDATGEEREMRRF
                     CGEDNPKYYKSRRSQVLVRFHKTVNYDGIGWVIRFAGVYSDHQIPRHLLGGS"
     misc_feature    61..447
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="N-terminal domain of cubilin and similar proteins;
                     Region: cubilin_NTD; cd22201"
                     /db_xref="CDD:412063"
     misc_feature    order(97..99,103..105,109..111,115..144,148..174,178..195,
                     208..210,217..222,226..231,238..243,247..252,259..264,
                     328..333,340..342,349..354,361..363,370..375,382..384)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:412063"
     misc_feature    97..111
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:412063"
     misc_feature    466..570
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    574..699
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    order(574..576,583..585,640..642)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    844..966
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="Calcium-binding EGF-like domain; Region: EGF_CA;
                     smart00179"
                     /db_xref="CDD:214542"
     misc_feature    order(844..846,853..855,901..903)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    970..1101
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="Calcium-binding EGF-like domain; Region: EGF_CA;
                     smart00179"
                     /db_xref="CDD:214542"
     misc_feature    order(970..972,979..981,1033..1035)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    1288..1371
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    1405..1509
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    1525..1866
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(1549..1551,1555..1557,1561..1563,1642..1644,
                     1657..1659,1777..1779,1849..1851,1855..1857,1861..1866)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    1879..2211
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(1906..1908,1912..1914,1918..1920,1999..2001,
                     2014..2016,2122..2124,2194..2196,2200..2202,2206..2211)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    2230..2547
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cl00049"
                     /db_xref="CDD:412131"
     misc_feature    order(2254..2256,2260..2262,2266..2268,2347..2349,
                     2362..2364,2476..2478,2536..2538,2542..2544,2548..2550)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    2557..2910
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(2581..2583,2587..2589,2593..2595,2674..2676,
                     2689..2691,2818..2820,2893..2895,2899..2901,2905..2910)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    2932..3282
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(2956..2958,2962..2964,2968..2970,3049..3051,
                     3064..3066,3193..3195,3265..3267,3271..3273,3277..3282)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    3298..3633
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(3322..3324,3328..3330,3334..3336,3415..3417,
                     3430..3432,3544..3546,3616..3618,3622..3624,3628..3633)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    3646..3990
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(3676..3678,3682..3684,3763..3765,3778..3780,
                     3901..3903,3973..3975,3979..3981,3985..3990)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    4336..4647
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(4339..4341,4345..4347,4351..4353,4432..4434,
                     4447..4449,4558..4560,4630..4632,4636..4638,4642..4647)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    4660..5001
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(4684..4686,4690..4692,4696..4698,4777..4779,
                     4792..4794,4912..4914,4990..4992,4996..4998)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    5374..5697
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(5398..5400,5404..5406,5410..5412,5491..5493,
                     5506..5508,5617..5619,5686..5688,5692..5694)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    5728..5994
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cl00049"
                     /db_xref="CDD:412131"
     misc_feature    order(5731..5733,5737..5739,5743..5745,5824..5826,
                     5839..5841,5929..5931,5983..5985,5989..5991)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    6055..6399
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    6418..6726
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    6787..7137
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(6811..6813,6826..6828,6832..6834,6913..6915,
                     6931..6933,7057..7059,7129..7131,7135..7137)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    7153..7533
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(7177..7179,7183..7185,7189..7191,7285..7287,
                     7300..7302,7516..7518,7522..7524,7528..7533)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    7546..7890
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(7576..7578,7582..7584,7663..7665,7678..7680,
                     7801..7803,7873..7875,7879..7881,7885..7890)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    <8497..8676
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cl00049"
                     /db_xref="CDD:412131"
     misc_feature    8692..9024
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(8719..8721,8725..8727,8800..8802,8818..8820,
                     8938..8940,9010..9012,9016..9018,9022..9024)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    9031..9381
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(9061..9063,9067..9069,9073..9075,9160..9162,
                     9175..9177,9295..9297,9364..9366,9370..9372,9376..9381)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    9388..9723
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    9760..10089
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(9778..9780,9784..9786,9790..9792,9871..9873,
                     9886..9888,10000..10002,10072..10074,10078..10080,
                     10084..10089)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    10135..10524
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(10144..10146,10150..10152,10156..10158,10237..10239,
                     10252..10254,10444..10446,10516..10518,10522..10524)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
     misc_feature    10591..10803
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cl00049"
                     /db_xref="CDD:412131"
     misc_feature    10867..11199
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="CUB domain; extracellular domain; present in
                     proteins mostly known to be involved in development; not
                     found in prokaryotes, plants and yeast; Region: CUB;
                     cd00041"
                     /db_xref="CDD:238001"
     misc_feature    order(10891..10893,10897..10899,10903..10905,10984..10986,
                     10999..11001,11116..11118,11188..11190,11194..11196)
                     /gene="Cubn"
                     /locus_tag="Dmel_CG32702"
                     /gene_synonym="CG2996; CG32702; CT7882; cubilin; dCubn;
                     Dmel\CG32702; tok-like"
                     /note="heterodimerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238001"
ORIGIN      
        1 atggaaggag ctgcgaggag cagactccta ttgtgttgga cactccttgc catcatcaca
       61 gatacttggc ccattgccga gggttttgtc aactcgccaa aaattataag caaagatggc
      121 aatttgattt ttgaatccgg tgcaaatcgc aatataagct ttcgattgag cggaaattcg
      181 cggcttacca tcaacgagga attggatgtt atggagctct tgctggccac cagtggctcc
      241 aaaaagcgtt ccggtggcaa ggatgatgat ttcgtagatg cgcgcgagct ggcggatcag
      301 ttggctgatt tcaataggcg cgcctttgga gcgaatggct tgagtgcaat gctgcgagtg
      361 cagcaaaata ggacccgagg atcgatggct ctgttgcggc gttttcagac acgactcaga
      421 gcgctggaga atcgggtgga tcgaatgaag accgatttgg aggcaaacag ctgtgcaagt
      481 ggaccctgcg agaatggagg cacctgctac aacacataca ccggattccg ttgccaatgt
      541 cgatcggcat tcgagggtac caagtgcgag atggatgtca acgagtgcgc actgtacgag
      601 ggcaccgatc tgggttgcca aaatggtgga caatgccaga atcatttcgg cacatacagt
      661 tgcctttgcc agccgggttg gcatgggatg cactgcaccc agcgcaaggc ggattgctca
      721 cagtccagtg catgggagct gtgtggccat ggatcttgtg tgcccagtgc agacgatgcc
      781 ggctatcgat gcatctgcga accgggttgg aagacgaatg gcttgacacc catttgtggc
      841 gaggatgtgg acgaatgcag cgattcggcc gcccacaagc cctgctccac cagctgcatt
      901 aatctgcctg gcagcttcac ctgtgctccc tgtccagccg gcttgaccgg gaatggggtc
      961 agttgccggg acttggacga atgccagacg aacaacggtg gatgcagtct tagtcccaag
     1021 gtagattgca taaataccta tggttcatat cattgcggcg agtgtcccgt tggctggacc
     1081 ggcgatgggc ggaagtgcga gagaagcccc caggacattg acatcccagc tggacagacg
     1141 ccaagaactt gtccggcggg caacaatccc tgctatccga cggcgagctg ctttttgatc
     1201 tccggcacca catcctgcag atgtccaatg ggcatggtgg gaacaggata cggtccgaat
     1261 ggctgtgtca atggcacgac cacaaactgc aaggaaaatc cctgcctgaa tggtggcatt
     1321 tgcctgttcg ccggaccctc gaattatacc tgcctgtgtc caattggctt ccgtccgccc
     1381 atctgtgagc cacagccgag tccttgcgat cagcatccat gcaagaatgg aggacgttgc
     1441 cgtcccacca ccagtgggga tctattcgtc tgccagtgtt tacctggcta ccggggacga
     1501 ctttgcgaga cgcgcttcag cagctgcaat ggaatgctga gtgcccagag tggcaggctt
     1561 aggtatccgc cggagggcac tggatacgag cacaatgccc agtgcgcttg ggttattcgc
     1621 accaacgaat cgctggtggt aaatgtcacg ttcaatagct tcgatgtgga ggattccacg
     1681 gaatgccgct tcgattggct gcagatcaac gatggccgtt cggcggctgc ccagataatt
     1741 ggacgctatt gtggtaacca tttaccgcat ggcgggaata tcgtatcatc cggcaatcaa
     1801 ctctatctat ggttccgatc cgataactcg acggctaaag agggattcga tctcacatgg
     1861 aactcgatgg agccgcagtg tggcggtcgc ttgaatttcg agacacatgg cacacttgcg
     1921 tcgccgggat cgcccggaaa ttatccgaag aatcgggact gccggtggca actggtggcg
     1981 cccaccacca aacgcatcaa gctgaccttc ttcagtttgc agctggagca gcacgcaaat
     2041 tgcaatttcg attatgtcct gatcaaggac agcatttccg gacgtgagct ggccaaatat
     2101 tgcaccacgg gagcgccagc accgctgctc ttgcccaccc acctggccga gatccacttc
     2161 cattcggatg ccgagggcag cgatactggc ttccagctgc actattccgt ggaggagcgt
     2221 gtgcccggct gcggtggtgt ctacaccgcc aaggagggca ccatttctga atcatccaca
     2281 gccaataccg aaccaggtgg tgtctcctgc gaatacgaaa tccatttggc cgtgggcgag
     2341 caggttgtca ttcagtttgc gcgtctggag ctggatccac ttgactgcct ggaggtgctg
     2401 gatatcacgg acgagggtgg tagcattttg caggagaaga tttgcggatc ggatgcgtcg
     2461 cgtttgaatc ctcctacctt cacttcggaa ttcaatcggc tgaagattaa gttttatgcc
     2521 cgtgccggca gcttccagtt gaactaccgg atggcctgcg attataaact gaataatgag
     2581 cagggcacca ttacctcacc cggttatccc aatctaacaa gatcggatcg tatctgcacc
     2641 tatacgatta gtacggccac caatacggtg attagtctga agaggatcga ctttcagttg
     2701 accaatggcg agagcgacga tgatgataac gatgaatgtc tgacaaccaa cttgagaatc
     2761 aacgatggat taaaccgaaa gatcctgggc ccctattgcg gcaagaatca gccggaggag
     2821 aactttgtca gcgaaaccaa ctacctgcag ttgcacctgt ccaccgatgt ggacagcatg
     2881 gggcgtggct ttaagttcga gtatcgagcc ctggccaccg gcaacgataa gtgcggtggc
     2941 gttcataccc gttccggcga tcatatccgc ttgccggtgc acgacgactc atatgccggc
     3001 gaagccacct gttactgggt gataatggcg ccggcaaaca aggccatccg cctccactgg
     3061 aacagcttca gtttggaaaa tgcggtggac tgcatctatg actatttgga gatctatgat
     3121 agtctgggtg cccaggtaaa tgacgagagg agcaagccgt tggccaaata ctgtggtaat
     3181 agtgtgccag aggatctgct cagccattcg cgtcagcttg tcctcaagtt cgtgtcggac
     3241 tacagcgaat cggatggagg ctttgattta acctacacct tcgaggatcg agccaagtgc
     3301 ggcggtcaca ttcatgcgtc cagcggtgag ctaacctcac cggaatatcc ggccaactat
     3361 tcggccggct tggactgcga ttggcatctg accggtacga ttgatcatct gctggagatt
     3421 caggtggaga actttgaact ggagcaatcg ccgaactgtt cagccgatta tctggaagtg
     3481 agaaatggag gcggcactga ttccccactg attgggcgct tctgcggacg ggatataccc
     3541 gctcggatac caggctttag ccacgagatg aggttgatcc ttcatacgga ttcggcgatc
     3601 aatggtcgtg gattccggct gcgctggcga atctttgcct tcggatgcgg cggaagtttg
     3661 cgttcgaata tgggcgccat ttcgtcgccc agatatccga actcgtatcc caacatggcg
     3721 cactgtgagt ggcgaattag cttgcatccg ggatcgggta tttcgcttct catcgaggac
     3781 ttggaactgg agggtttgag caattgttac tacgacagcg tgaagatcta cacgggcatt
     3841 aagctgccca atcagagccc ctgcaaagta ctctgcaagg acgatgatct gcataatccg
     3901 ctcattcagc tggagaacaa taagggcacc attgtcttcg attctgatgc gtccaacaca
     3961 ttccgtggct ttcgaatatc ctacaaggcg aattgcattc gaaaccttac ggccacgacg
     4021 ggaaccattg agagtctgaa ctacatggaa ccattctggg agaccatacc catcaattgt
     4081 agttggacta ttcgtgcgcc caagggcaat cgcgttctag tggaagtctc acatttggca
     4141 cggcacgaac agcacgtccc gactgccacc atgcccggcg gattgtacat tgtggacggc
     4201 aggaatgtcc aggaaatagt cacaccacaa gcgatgaaca tcagcggcga agtgctgacc
     4261 gtcgtccaca atgccagcaa tgtgaacttt cagctggact atcgcatcga tggctgcatg
     4321 gaggagctgc gcggcacgtt cggattcttt caatcgccca attatccaaa aatgtatccg
     4381 aacaacctgg agtgctattg gctgatcacc gtcgagcagg atagcgccat cgagcttacg
     4441 atcaacaaca tagatctcga ggacagtccc aattgtacca aggatgcgct gacggtttcc
     4501 aatcataaga attcggtgga agtccacgaa cgacattgcg gttccacgac caaattggtg
     4561 atcaccagtt cgggtcacag gctgcacgtg cgtttcatct cggacaattc gcacaatgga
     4621 ctcggttttg aagccaccta tagaactgtg aaagcaactt gtggtggcaa attgacggcg
     4681 cgaaacggag tgatcgaatc gccaaattat ccgctcaatt atccagctca cagtcgatgc
     4741 gagtggcagg tggaggtctc ccagcaccac cagatcgttt tcgagatggc ggatcttaat
     4801 cttgagtcgg gctacgactg caactgggat tatctggagg cctacgatct gacggaggac
     4861 gacacggagg gtgaaagatt gttcaaggtc tgcggcgacg agacggaaga tgacaagctg
     4921 ctttcttcct catccaatat ggctgtggtg cgatttatca gcgatgattc cgtttcgaaa
     4981 aagggcttcc ggctgcactt ccacgagtcc tgtggccaaa cgataatcgt tgatgaaaca
     5041 atgtttgatt acatccaaat gtccaggcag gcggcccgaa acgagagctg cttatgggta
     5101 ttccaagccg tggagcccaa caaacgcatc atctttacgc ccacccatgt gaagctgcgc
     5161 gaggatgcca accagcaata tcccacggag ggtgattgcc tcaatgtggg agttaagatc
     5221 tacgagggta cagagccgca gggaacaccg cgtctcaagt tctgtcgctc gcatccgccg
     5281 gccttgattt ccaatggcca ggctctgacc gtcagtgtgc cgctccagct ggtggaggag
     5341 ttccaaggac actacatgac catggacacg tcctgcggca gtatttacaa tgctctgtcc
     5401 ggaaagttca cttcacccta ttaccccgcc tcgtatccgc caaacattga atgcctgtgg
     5461 ctgctggaag ccagcatggg taactccctc agtctcacgc tggagtcgat ggacttggag
     5521 aagtcagaga gttgcaatcg ggattatctg gaagtgcgcg aggaatcgga gagcggccaa
     5581 ctgatcggcg tttactgtgg caacgaagtg cccggcgtga ttcactcgcg cggtgccatc
     5641 tggatgaagt tcaagagtga cgacgacaat gtgggcgagg gattcatggc ctcctataac
     5701 tacgagcacc acaacgagct gaatggcact gaaggcacca ttgaatcgcc gcactttcca
     5761 agcaaattcc aggatccggt gccgtacagc tggcgcatta cggtggacaa ggagtacgtg
     5821 gtggcgatat ccctgctcta tctgagggat ctggaccaac cgcatttaaa tttctacgac
     5881 ggctattcgg acattggagc tcgtatcgag gtgactgatc ccgacgaaac catcatctcc
     5941 agcacgaatg tggtttactt cacgagcaat cgaggtcctt tcaagttaaa ttggaatcga
     6001 ttatccaagg aggcgctacg ttcgaatcgt acggcagagg agcggacacg ccagtgtggc
     6061 aatcagttga ttacaatcga tcgatcggtg atcggatttc attcgcctgg ctatcccaat
     6121 ggctacgagc aggatctcaa ttgcttctgg actttggtgc cctcgaatcc ggctatgcat
     6181 gccgtactca cactgtccca aatcgatctg gagatattta gcgaagattg cattgctgac
     6241 tatgttaaga tttttagtgg gagcgatctg cagaactggt cggagctaag aacgttgtgc
     6301 tccctgccca cggagtcgag tgaccgagtc tttcatggaa ggccctatct cagggtggaa
     6361 ttcgtgacgg atccaagtgt gaataagacg ggattcaatg gcattgtgcg cacggcctgc
     6421 ggttcggaaa tcactgcctc caagggactg gttaacatta cggagatcct gaaggtcctt
     6481 ccgcggccaa accacgattg tgtgtggacc ataaaagtgc gccagggccg tagaatcaag
     6541 atcgacttcc ccgacttcca gttgcagaac aacatggcct ccggatcgag tgattgccga
     6601 aattatcttc tactccgcaa tggaaacgat gaagattcgc ccttcttggg acgtggcaag
     6661 tactgtgagg atgtcgtgca cgaggtcctg aacacctcct cgaataaggc ctatataaag
     6721 ttccactttg cgagtccacc ccgcttcctg gtgtccttcc gcttcgagga actgcgttac
     6781 accgactctg gccgtatccg attgtccgcc tccggagatg agcagttcat tagctcaccg
     6841 tattacccac atcttccgca tccccattcc gagtgcattt ggatcgttga agcaccacca
     6901 gaacaccgca taatgctgca ctttcaaggc gcattcgata tgttggacgc caccggggaa
     6961 ccggaggagt gccaacggga atttgttttg atcaacgatg gcagtacgga gctaagaccg
     7021 gagatcggtc gctattgtgg caatcgtaag ccggatacga tctactccac cggtaaccag
     7081 atgaggattc gctacttcac cgatgtctcg gagccacata tgggcttcaa tgccagtttg
     7141 agtgtggccc gatgcggagg ctccttccat agtcccgagg gcgtgatagc ctcgccgtcg
     7201 agggacctcc tgttgattca cgaggaaggc aagcagctgc aggaatgcgt ttacaccatc
     7261 gaactggaga agggcagcac catcgatctg actagcgaat atctgcagat acccacgttg
     7321 cggaatggta gctgctcgca gcgaaatcac ttgatgctcg aagagatgga tgcctttgga
     7381 ttggacggtg aggagaagat cgtggacacc ctaatgctct gcggtatgga agccaagcac
     7441 ctgataagtg agacgaacaa gatcgtgttc cgatatcgct tcctggatgg cattccggcg
     7501 gagaatcagg gcttccgttt aaagtacacc tcgctgggct cacgatgcgg cgagaccatc
     7561 tacgcatccg tgggagttct ccaaacaccc ggttatccct taggcgtacc ccatcccatg
     7621 cactgcaagt ggcaggtgca agtgcccaag ggcagaaggg tgcgtctgga gattctcgac
     7681 tttaacaccg gcacgaatat ggatctcaga ggaaggcttg gattccgtgg ccgccttacc
     7741 gtggccaacg atttcaaaat gcaatccatc ctgggtcgct acaacgtcga tcctcctgcg
     7801 gaggtgcttt cctcggacaa tacaatgggc atcgatgcct tcctactgcc cattgttcag
     7861 aatcatggaa tcaagctgcg gttcagtgcc tatggctcca gtagctgtcc gggattcacg
     7921 gtaatgatga atgaggtcgc agatattcag ttccagcggt tcaatatcag ccgtccgctt
     7981 cactgcagct ataaagtcgt tccaccgtcc aatagtaccc tcctgattcg ggtgaaagag
     8041 tacaacacca cgtccgtaat gatgtggaat acacatatgt gcgcattgct ctcgccgctt
     8101 aagtttaacc gcttggagca ggaggaggag ctcatggagc gcattctctg cgattaccag
     8161 tcacccgctc ctggcaagcc cctgccctcc atccggttgc ctttccccat tcaactggtc
     8221 gtctcggcat ccgcccgcaa cgcaatgacc aatctcgtcc tgagctatag cacacagtcg
     8281 tgcggcggag tcattatcct ggaaccgggt gataatatga cggtgcacca gccatcggga
     8341 atggtgtcgg cggcgggcgc cattgactgt gcctgggcca ttggacccta tacggatgcc
     8401 agtggcgagg acgaggtcct ggtgccgcag gacattcagc tggaggtgtc ggtatataac
     8461 gtcaacctgc cagcaccgag cccgtccgca caatctccgg aagccccatg cctgcatcac
     8521 tatcttaagg tatacaatgg acccgatcag aactcaccat cgttgggact gttttgcaat
     8581 caggccacag ctgtgaacat ggtggtggag cgaggtctct tcctggaata tcactccgat
     8641 agtttctcag ccaatgccac cttcaatgtg tccatcaagt atggatctgg atgcggtggc
     8701 aagttggtat atccctatag agccatcgac tttgccgagc aatacaagaa caatgtggag
     8761 tgcatctggg aggtcgaggc gacaatgggc taccacatcg gtctaacatt ccaaggacgc
     8821 ttttatatcg aggatagccc cggttgcaca aaggattacc tgctcgtcca gcagcgcaac
     8881 gagaccactg gcaattggac cgacctgcag aggatttgcg gtcgtgttgc gccggagatg
     8941 ataaacacaa cttcaccgta tctccggcta atcttccgat ccgatggcga tgtggtggcc
     9001 gatggttttt tggccaaatt cgaaaggaat tgcggtggcc tgctgtacgc cgacagcacg
     9061 gaacaggagc tggccagtcc gggctttccg aatggctatg aaaagtactt gcaatgtaat
     9121 tggacgatag tgcccaggag tccatcgatg ggcggtgtcc tggtcagctt tgtcaatttc
     9181 gatctggaac agggacccat atccgtttgc ctctacgaca atctcacggt gaccacaaag
     9241 gacaagggca aggatccgca acagaccact ctctgcggcg taaagcataa ccacgagtat
     9301 cggggcaagg aatatgttaa tctactgctc cgaacggatg gcagttattc cggtcgcgga
     9361 ttcacattac tctataccag ccgcctttgc ggtggaatta tctcgcgaac atcaatggtg
     9421 gaatcacccg tacagcatac ggataacacc ctgccacctg gcagtgattg ctattggaat
     9481 ctaaccgccc cggctggtta caagttcaac attaagttcc tattcattga ctttgaggcg
     9541 aatagcaatt gtgcctacga tggcgtcgag gtattctccg gacccatccc ggacgagcga
     9601 taccgatggg gacgcttctg cggtcgcatt aacgaggatc tgccactgat cagtattccc
     9661 caagagcggg gcatcataca cagcttctcg gatgatcggg atccatcgag gggattccgt
     9721 gccttggtgc gcgtaatgcc aaattgcgat gagaagatct cgctgaacgg atcgtcgcgt
     9781 tatgtctata gcaaatttaa caacgctggc ggttatcaaa acgatttgga ctgtcaaata
     9841 gtattccggg tgaatcctga tcagcagata agcgtggagt tcagtaattt ccatgtccaa
     9901 gacacggacg gatgccgcag tgattatgtg gagttgcgcg atggtggcgg aacctttgcc
     9961 gacattatcg gacgtttttg tggccagaat caaccgccca ccttgagaac aaccaggcat
    10021 acgctctata tgcgctttgt caccgataat aaggtgacgg atacgggttt ccaggtgacc
    10081 atcaatgcta ttccccgact atgcggcagt tcagagatta cgttgagtgc ggatggcacc
    10141 aaggaggtca ccattaattc tccggcaagg acgccaggtg gcaattatcc caatggagtg
    10201 tcgtgcttct ggaaaattaa gggcgattcc ctgctgaggg tgcagttcgt caactttgat
    10261 ctccacggac cgaatcaaaa tggtagctgc gtggatgact atttgaaaat ctacaatagt
    10321 gaggatgcac cgctgttgga gcagggattg ggcaccgacc tggtattcaa tggccagacc
    10381 tccagtaaga acggtttcgg ctttgccacg gagcatgtgt actgcggcaa tgtgaagccg
    10441 gacatctatt atggccggtc cagcgaggtg tatctgaagt tccggtcaaa gggattggag
    10501 cagcatggtg gatttcagtt acaggtcgct ctgaactcca accgagagcg ccactacgat
    10561 ggactgcagg gcagagtgca tttatcacag tcggccgatt gtaacatcat tattcgggcg
    10621 ccaccaaatt acaccttaag tttgtactac accgaattga tattcggcac ctacgactgc
    10681 gaaatggaga atttggaggt gttcgacagg acgaatcgat cgctgcagcg cgtctgctcc
    10741 tttgtggaca tgggcaagag cctgttcagc aatgcgaatg aactgcggct acagatgaag
    10801 actggctcgt acttgacctc gctggatctc acctatttgg ccagtccggt ggagaagggt
    10861 cctggttgcg gtggtcaatt ctacaatacc gagggcatat tctcaaatcc cttctatccg
    10921 aacaatgtgc gcaataactc agagtgtcag tggattgtcc gcgtgccgag caacaatgtt
    10981 gtgttcctta catttgaagt cttcaatctg ggctcgaaga ccacctgtca cacggactac
    11041 ctgcaaatcc tggaacagga cgcaaccggt gaggagcgcg aaatgagacg cttctgtggc
    11101 gaggataacc caaagtacta caagagccgg cgcagccagg tgctcgtccg ctttcacaag
    11161 accgtcaact acgatggtat cggttgggtg atccgctttg ccggtgtcta ctccgaccat
    11221 cagataccca gacacctgtt gggcggttct taaccgcttg atttcttctt cagccgcaat
    11281 ctgtattaag aagcttaaaa ttcctacaat taaatcattt ctattgcaat aaatacatct
    11341 aaataaagg