Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Drosophila melanogaster megalin, transcript variant C (mgl), mRNA.


LOCUS       NM_001298124           16625 bp    mRNA    linear   INV 26-DEC-2023
ACCESSION   NM_001298124
VERSION     NM_001298124.1
DBLINK      BioProject: PRJNA164
            BioSample: SAMN02803731
KEYWORDS    RefSeq.
SOURCE      Drosophila melanogaster (fruit fly)
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 16625)
  AUTHORS   Matthews,B.B., Dos Santos,G., Crosby,M.A., Emmert,D.B., St
            Pierre,S.E., Gramates,L.S., Zhou,P., Schroeder,A.J., Falls,K.,
            Strelets,V., Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: Impact of
            High-Throughput Data
  JOURNAL   G3 (Bethesda) 5 (8), 1721-1736 (2015)
   PUBMED   26109357
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 16625)
  AUTHORS   Crosby,M.A., Gramates,L.S., Dos Santos,G., Matthews,B.B., St
            Pierre,S.E., Zhou,P., Schroeder,A.J., Falls,K., Emmert,D.B.,
            Russo,S.M. and Gelbart,W.M.
  CONSRTM   FlyBase Consortium
  TITLE     Gene Model Annotations for Drosophila melanogaster: The
            Rule-Benders
  JOURNAL   G3 (Bethesda) 5 (8), 1737-1749 (2015)
   PUBMED   26109356
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 16625)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Wan,K.H., Park,S., Mendez,I.,
            Galle,S.E., Booth,B.W., Pfeiffer,B.D., George,R.A., Svirskas,R.,
            Krzywinski,M., Schein,J., Accardo,M.C., Damia,E., Messina,G.,
            Mendez-Lago,M., de Pablos,B., Demakova,O.V., Andreyeva,E.N.,
            Boldyreva,L.V., Marra,M., Carvalho,A.B., Dimitri,P., Villasante,A.,
            Zhimulev,I.F., Rubin,G.M., Karpen,G.H. and Celniker,S.E.
  TITLE     The Release 6 reference sequence of the Drosophila melanogaster
            genome
  JOURNAL   Genome Res 25 (3), 445-458 (2015)
   PUBMED   25589440
REFERENCE   4  (bases 1 to 16625)
  AUTHORS   Hoskins,R.A., Carlson,J.W., Kennedy,C., Acevedo,D., Evans-Holm,M.,
            Frise,E., Wan,K.H., Park,S., Mendez-Lago,M., Rossi,F.,
            Villasante,A., Dimitri,P., Karpen,G.H. and Celniker,S.E.
  TITLE     Sequence finishing and mapping of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1625-1628 (2007)
   PUBMED   17569867
REFERENCE   5  (bases 1 to 16625)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  TITLE     The Release 5.1 annotation of Drosophila melanogaster
            heterochromatin
  JOURNAL   Science 316 (5831), 1586-1591 (2007)
   PUBMED   17569856
  REMARK    Erratum:[Science. 2007 Sep 7;317(5843):1325]
REFERENCE   6  (bases 1 to 16625)
  AUTHORS   Quesneville,H., Bergman,C.M., Andrieu,O., Autard,D., Nouaud,D.,
            Ashburner,M. and Anxolabehere,D.
  TITLE     Combined evidence annotation of transposable elements in genome
            sequences
  JOURNAL   PLoS Comput Biol 1 (2), 166-175 (2005)
   PUBMED   16110336
REFERENCE   7  (bases 1 to 16625)
  AUTHORS   Hoskins,R.A., Smith,C.D., Carlson,J.W., Carvalho,A.B., Halpern,A.,
            Kaminker,J.S., Kennedy,C., Mungall,C.J., Sullivan,B.A.,
            Sutton,G.G., Yasuhara,J.C., Wakimoto,B.T., Myers,E.W.,
            Celniker,S.E., Rubin,G.M. and Karpen,G.H.
  TITLE     Heterochromatic sequences in a Drosophila whole-genome shotgun
            assembly
  JOURNAL   Genome Biol 3 (12), RESEARCH0085 (2002)
   PUBMED   12537574
REFERENCE   8  (bases 1 to 16625)
  AUTHORS   Kaminker,J.S., Bergman,C.M., Kronmiller,B., Carlson,J.,
            Svirskas,R., Patel,S., Frise,E., Wheeler,D.A., Lewis,S.E.,
            Rubin,G.M., Ashburner,M. and Celniker,S.E.
  TITLE     The transposable elements of the Drosophila melanogaster
            euchromatin: a genomics perspective
  JOURNAL   Genome Biol 3 (12), RESEARCH0084 (2002)
   PUBMED   12537573
REFERENCE   9  (bases 1 to 16625)
  AUTHORS   Misra,S., Crosby,M.A., Mungall,C.J., Matthews,B.B., Campbell,K.S.,
            Hradecky,P., Huang,Y., Kaminker,J.S., Millburn,G.H., Prochnik,S.E.,
            Smith,C.D., Tupy,J.L., Whitfied,E.J., Bayraktaroglu,L.,
            Berman,B.P., Bettencourt,B.R., Celniker,S.E., de Grey,A.D.,
            Drysdale,R.A., Harris,N.L., Richter,J., Russo,S., Schroeder,A.J.,
            Shu,S.Q., Stapleton,M., Yamada,C., Ashburner,M., Gelbart,W.M.,
            Rubin,G.M. and Lewis,S.E.
  TITLE     Annotation of the Drosophila melanogaster euchromatic genome: a
            systematic review
  JOURNAL   Genome Biol 3 (12), RESEARCH0083 (2002)
   PUBMED   12537572
REFERENCE   10 (bases 1 to 16625)
  AUTHORS   Celniker,S.E., Wheeler,D.A., Kronmiller,B., Carlson,J.W.,
            Halpern,A., Patel,S., Adams,M., Champe,M., Dugan,S.P., Frise,E.,
            Hodgson,A., George,R.A., Hoskins,R.A., Laverty,T., Muzny,D.M.,
            Nelson,C.R., Pacleb,J.M., Park,S., Pfeiffer,B.D., Richards,S.,
            Sodergren,E.J., Svirskas,R., Tabor,P.E., Wan,K., Stapleton,M.,
            Sutton,G.G., Venter,C., Weinstock,G., Scherer,S.E., Myers,E.W.,
            Gibbs,R.A. and Rubin,G.M.
  TITLE     Finishing a whole-genome shotgun: release 3 of the Drosophila
            melanogaster euchromatic genome sequence
  JOURNAL   Genome Biol 3 (12), RESEARCH0079 (2002)
   PUBMED   12537568
REFERENCE   11 (bases 1 to 16625)
  AUTHORS   Adams,M.D., Celniker,S.E., Holt,R.A., Evans,C.A., Gocayne,J.D.,
            Amanatides,P.G., Scherer,S.E., Li,P.W., Hoskins,R.A., Galle,R.F.,
            George,R.A., Lewis,S.E., Richards,S., Ashburner,M., Henderson,S.N.,
            Sutton,G.G., Wortman,J.R., Yandell,M.D., Zhang,Q., Chen,L.X.,
            Brandon,R.C., Rogers,Y.H., Blazej,R.G., Champe,M., Pfeiffer,B.D.,
            Wan,K.H., Doyle,C., Baxter,E.G., Helt,G., Nelson,C.R., Gabor,G.L.,
            Abril,J.F., Agbayani,A., An,H.J., Andrews-Pfannkoch,C., Baldwin,D.,
            Ballew,R.M., Basu,A., Baxendale,J., Bayraktaroglu,L., Beasley,E.M.,
            Beeson,K.Y., Benos,P.V., Berman,B.P., Bhandari,D., Bolshakov,S.,
            Borkova,D., Botchan,M.R., Bouck,J., Brokstein,P., Brottier,P.,
            Burtis,K.C., Busam,D.A., Butler,H., Cadieu,E., Center,A.,
            Chandra,I., Cherry,J.M., Cawley,S., Dahlke,C., Davenport,L.B.,
            Davies,P., de Pablos,B., Delcher,A., Deng,Z., Mays,A.D., Dew,I.,
            Dietz,S.M., Dodson,K., Doup,L.E., Downes,M., Dugan-Rocha,S.,
            Dunkov,B.C., Dunn,P., Durbin,K.J., Evangelista,C.C., Ferraz,C.,
            Ferriera,S., Fleischmann,W., Fosler,C., Gabrielian,A.E., Garg,N.S.,
            Gelbart,W.M., Glasser,K., Glodek,A., Gong,F., Gorrell,J.H., Gu,Z.,
            Guan,P., Harris,M., Harris,N.L., Harvey,D., Heiman,T.J.,
            Hernandez,J.R., Houck,J., Hostin,D., Houston,K.A., Howland,T.J.,
            Wei,M.H., Ibegwam,C., Jalali,M., Kalush,F., Karpen,G.H., Ke,Z.,
            Kennison,J.A., Ketchum,K.A., Kimmel,B.E., Kodira,C.D., Kraft,C.,
            Kravitz,S., Kulp,D., Lai,Z., Lasko,P., Lei,Y., Levitsky,A.A.,
            Li,J., Li,Z., Liang,Y., Lin,X., Liu,X., Mattei,B., McIntosh,T.C.,
            McLeod,M.P., McPherson,D., Merkulov,G., Milshina,N.V., Mobarry,C.,
            Morris,J., Moshrefi,A., Mount,S.M., Moy,M., Murphy,B., Murphy,L.,
            Muzny,D.M., Nelson,D.L., Nelson,D.R., Nelson,K.A., Nixon,K.,
            Nusskern,D.R., Pacleb,J.M., Palazzolo,M., Pittman,G.S., Pan,S.,
            Pollard,J., Puri,V., Reese,M.G., Reinert,K., Remington,K.,
            Saunders,R.D., Scheeler,F., Shen,H., Shue,B.C., Siden-Kiamos,I.,
            Simpson,M., Skupski,M.P., Smith,T., Spier,E., Spradling,A.C.,
            Stapleton,M., Strong,R., Sun,E., Svirskas,R., Tector,C., Turner,R.,
            Venter,E., Wang,A.H., Wang,X., Wang,Z.Y., Wassarman,D.A.,
            Weinstock,G.M., Weissenbach,J., Williams,S.M., WoodageT,
            Worley,K.C., Wu,D., Yang,S., Yao,Q.A., Ye,J., Yeh,R.F.,
            Zaveri,J.S., Zhan,M., Zhang,G., Zhao,Q., Zheng,L., Zheng,X.H.,
            Zhong,F.N., Zhong,W., Zhou,X., Zhu,S., Zhu,X., Smith,H.O.,
            Gibbs,R.A., Myers,E.W., Rubin,G.M. and Venter,J.C.
  TITLE     The genome sequence of Drosophila melanogaster
  JOURNAL   Science 287 (5461), 2185-2195 (2000)
   PUBMED   10731132
REFERENCE   12 (bases 1 to 16625)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Pfeiffer,B., Frise,E., George,R.,
            Hoskins,R., Stapleton,M., Pacleb,J., Park,S., Svirskas,R.,
            Smith,E., Yu,C. and Rubin,G.
  CONSRTM   Berkeley Drosophila Genome Project
  TITLE     Drosophila melanogaster release 4 sequence
  JOURNAL   Unpublished
REFERENCE   13 (bases 1 to 16625)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   14 (bases 1 to 16625)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2023) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   15 (bases 1 to 16625)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   16 (bases 1 to 16625)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-2020) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   17 (bases 1 to 16625)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2019) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   18 (bases 1 to 16625)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2018) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   19 (bases 1 to 16625)
  CONSRTM   FlyBase
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2016) FlyBase, Harvard University, Biological
            Laboratories, 16 Divinity Ave, Cambridge, MA 02138, USA
REFERENCE   20 (bases 1 to 16625)
  AUTHORS   Celniker,S., Carlson,J., Kennedy,C., Wan,K., Frise,E., Hoskins,R.,
            Park,S., Svirskas,R. and Karpen,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One #Cyclotron RoadOne
            Cyclotron Road, MS 64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   21 (bases 1 to 16625)
  AUTHORS   Celniker,S., Carlson,J., Wan,K., Frise,E., Hoskins,R., Park,S.,
            Svirskas,R. and Rubin,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2006) Berkeley Drosophila Genome Project,
            Lawrence Berkeley National Laboratory, One Cyclotron Road, MS
            64-121, Berkeley, CA 94720, USA
  REMARK    Direct Submission
REFERENCE   22 (bases 1 to 16625)
  AUTHORS   Smith,C.D., Shu,S., Mungall,C.J. and Karpen,G.H.
  CONSRTM   Drosophila Heterochromatin Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2006) Drosophila Heterochromatin Genome Project,
            Ernest Orlando Lawrence Berkeley National Laboratory, 1 Cyclotron
            Road, Mailstop 64-121, Berkeley, CA 94720, USA
REFERENCE   23 (bases 1 to 16625)
  AUTHORS   Adams,M.D., Celniker,S.E., Gibbs,R.A., Rubin,G.M. and Venter,C.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2000) Celera Genomics, 45 West Gude Drive,
            Rockville, MD 20850, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by FlyBase. This
            record is derived from an annotated genomic sequence (NC_004354).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: FlyBase
            Annotation Status   :: Full annotation
            Annotation Version  :: Release 6.54
            URL                 :: http://flybase.org
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..16625
                     /organism="Drosophila melanogaster"
                     /mol_type="mRNA"
                     /db_xref="taxon:7227"
                     /chromosome="X"
                     /genotype="y[1]; Gr22b[1] Gr22d[1] cn[1] CG33964[R4.2]
                     bw[1] sp[1]; LysC[1] MstProx[1] GstD5[1] Rh6[1]"
     gene            1..16625
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Megalin"
                     /map="8D9-8E4"
                     /db_xref="FLYBASE:FBgn0261260"
                     /db_xref="GeneID:8674055"
     CDS             498..14807
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="CG42611 gene product from transcript CG42611-RC;
                     CG42611-PC; mgl-PC; LDL receptor-related protein 2"
                     /codon_start=1
                     /product="megalin, isoform C"
                     /protein_id="NP_001285053.1"
                     /db_xref="FLYBASE:FBpp0310026"
                     /db_xref="GeneID:8674055"
                     /db_xref="FLYBASE:FBgn0261260"
                     /translation="MNPTPVGIGFGFGRKPPSKARMRSRWRPPSATTLLTHDPANGDS
                     HTAADPLQVTDAAPSGPPSSSSSSPIGDRHSQHHSSSAIDRRLQQQQHHQSPQHHRQR
                     GQLTTLALLLLALVAISNLETLLAVRTEGPRNRHGSPGGSLASTGGSSSGINTECPTD
                     SFRCNNGKCISHHWVCNYQKDCDDGEDEMQSCPPPECETPQLNCGQYTFNKTYCIPPH
                     YRCDMIEDCEDKSDEAQCTYRKCQHTDLFCNTPTGAPAEGARLTGPCVPKEKRCDGYL
                     DCRTGRDEVGCSGVACRLDQFRCANGLKCIDAALKCNHRDDCGDNSDEQGCNFPPCHH
                     AQFRCTNALCIPYNFHCDGYHDCADKSDEANCTAIACPDNKHLCPRGGASGTPKCILK
                     SQLCDGKRDCEDGSDEETNCSIASCPALSCEFKCGPSLTGGVCYCKPGQSLAPDNRTC
                     VDLDECAEWGHCDQLCTNTLGSYTCQCAQGYTLINDSKCIAPDANNLQLIFAHDRAIM
                     RMLPHGSEPKILANATAAAGVTFHYARNTLYWSDIKTRKVQSLPLDAQNKAVSPFDQT
                     LPGTWAPVALAVDWVGDKIYVADLVGQKIDVFELSGQWHAVVLGSNLTSPADLALDPT
                     AGLMFVADGGQVLRAHMDGTHARSIVSEAAYKASGVTVDIISKRVFWCDSLLDYIESV
                     DYEGAHRVMVLRGQQVPSPSRLALFENRIYWTDATKQGIMSVDKFEGPTSIQVTYKAK
                     DIREPKGIIAVHALSQPRVSNPCGNNNGGCNHMCIVTAVKGAPTGLGFRCACSTGYQL
                     ETDLKLCKPVSEFLMYSQQRFIKGKVLEPVIEGFSDAIMPVVSRRARFVGLDFDARDE
                     FIYYSDVLQDVIYRVHRNGTGREIVLASQNEGVEGLAVDWASKNLYYIDSRKGTLNVL
                     STRNVTHRRTLLKNLKRPRAIVVHPNRGFIFFSEWDRPANITRANTDGSGLLVFKNVT
                     LGWPNGLSIDFKEDRVYWCDALLDHVQHANLDGTDIKTVNSRLVRHPFSIVIHNDWMY
                     ITDWRLDAIIRLHKLTGEQEEMMVREPQTNRLYGVKVYSHEVQRIADTQPCHRNNGGC
                     QKICFAVPIGASNGTDGVTTSSPSFGRLQSRCSCPYGERLADDQVSCIPDPSAEPPVQ
                     PCPNSWDFTCNNQRCIPKSWLCDGDDDCLDNSDEEQNCTKPTCGSNEFQCRSGRCIPQ
                     NFRCDQENDCGDNSDEQECGNVTCGTSQFACANGRCIPNMWKCDSENDCGDSSDEGDF
                     CAEKTCAYFQFTCPRTGHCIPQSWVCDGDDDCFDKQDEKDCPPISCLANQFKCADLRQ
                     CVEESYKCDGIPDCNDGSDEVGCPSMGPNQCNLEKHFRCKSTGFCIPIAWHCDGSNDC
                     SDHSDEQDCGQITCAQNFFKCNNTNCVFKAYICDGKDDCGDNSDEGAEHACVPPPFKC
                     PHGQWQCPGVSERCVNITSVCDDTPDCPNGSDEGEGCDLAECEHQAGQCSSFCQKTPN
                     GALCVCPPGSEIGEDGYTCIDSNECDPPGLCSQQCTNTKGSYFCSCTDGYVLEPNKHT
                     CKAVNHTAAFLIISNRHSILVADLKEQGLERVPIIVENVVATASNMHTGTIFWSDMKL
                     KKISRLDRGMEPQEIINTGLDLVEGLAYDWIAQNLYWLDSKLNTIEVSAENGSNRLVL
                     VRENITQPRGMCIDPSPGARWIFWTDWGENPRVERIGMDGTMRKTIINTKIYWPNGLT
                     LDIATKRVYFADSKLDFIDFCYYNGTGRQQVLASSHYLLHPHSLSLFEDTLYWTDRQL
                     NRVLSANKFRGKNQTVVSHLISQPLSIHVHHASLQPMTPNPCAGSRCQHLCLLSPSAP
                     EGYSCKCRPGFKLLSEGRCIEEENPFLMVVKGTQIVDLPLNGGDARAGALAPVIGIES
                     STGLDFDRKGETLYWVQGREDDDENCTIYTTPYGGGNKTLFLGIENGIVGAPYTIAFD
                     WLGRNLYIGNRVASNIEAVRVDGKQKYRTIILANDGYPNSVSRPKQIALDPTEGKLFW
                     IDEGVLEVPIKIGRVDMNGQNPIVVFQEFAHPESLAVDTEKKMVYYSASNPAVIGVMD
                     YNGDDHTLILMKDSHPMAKPRSLGILDHRLYYLDPLYERIVRIDLPHGDNPKTIVDNE
                     SDLRSMMIYKKRALMQHPCQTNNGGCKHLCIPGPGATRTCACGIGYRKENEINCVAYK
                     IFAVVSQLDMIRGYSLSDSSEAMVPISGPGHHILHVDVMYREQWIYWAEYNRGYWNGI
                     FRSRPNGTDLQHVVKDGIGSNGIRGLTIDWVAGNMYFTNVYPHENYVEVCWLDGSNRK
                     VLVKTTTDAPRELAVNPIKRLLYWIDYGQHPRIGKALLDGSKWTPLVTSGISLPRDLT
                     IDMQTHDIYWVDSKLDTIQKISYNGANRKIIRRDLPNPMGIAVYLNDVYWVDRNLMTV
                     FKASKHSANETATSVRTNLEKLRDIAIYNINNQPQDDTNPCAHLGNGGCDQLCFSFPP
                     DGGASGTSGGRNFRCECATGKLSADERKCEVVNEYLVFATRTEIRAVNLDPHSTEVPF
                     TPLTNLTNVVGLDFDFAHNRMLYTQIRPWAKIAYTKANKPGHDDITVVLNKGINPEGI
                     AYDWTQQKIYWTDSSNNSIYAMNLDGSELVMIARVERPRAIVLDPCNGTLFFTDWGRF
                     GTSGKIFRTTMAGSLKRAIVDKDLSQPSGLAIDYDERRLYWTDAVREKIERSDLDGQN
                     RELLVAATIYPFAITVFRNYIYWTDLQLRGVYRAEKHTGANMVEMVKRLEDSPRDIRI
                     YSSDRQKCNVNPCRINNGGCAQSCHPAPNGKAECKCDDSTKVVNEGRMCAPRNNTCEA
                     SKFYCKNGRCISRMWSCDGDDDCGDNSDEDPNYCAYHSCSPNEFRCNNGRCIFKSWKC
                     DHENDCKDGSDELGCVYPPCVDGEFTCANGRCIPQAQVCNGVNDCKDNATSDETHERC
                     PMNTTCPANHLKCEKTNICVEPYWLCDGDNDCGDNSDEDPLHCGQRTCPTNSFRCPNH
                     RCIPATWYCDGDDDCGDGADEPPDYCKSEGRTCFGDLFTCDNGNCIPRIYICDGDNDC
                     LDNSDEDNRHQCNDRKCDEETEFTCVENKSWQRAQCIPKKWICDGDPDCVDGADENTT
                     LHNCATQQPCGEDMFTCGNGRCINKGWICDHDNDCGDGTDEGKFCNSKYKTCSAQEFT
                     CQNFKCIRNQSRCDGEDDCGDHSDEVGCAKENITCPQGQFACTNGQCIDYNLVCNKYP
                     DCADESDEPAHCNVDECAKVEINQCGHKCVDTLTGYYCDCNEGYKLLADGKACADVDE
                     CLEQPGACSQHCSNTPGGFYCKCDETYYERQNDEHTCKRKDKIPPWLIFTNKYYVRNM
                     SVDGHQYNLMHQDLMNVVALDFDIREEYMYFCDVTAKTIFRAKYGEADDEMPPEREAV
                     IRHDSHGLEGIAIDWVGRKLYWLDRHSKNLDVSELDGSKRKTLRSGVVDPRAIVVHPG
                     IGYLYFTSWHLQAYIAKMGMDGSNFSRILNWNDGIAWPNALSIDYFTDRIYWADAHLD
                     YIAYADLEGRHRHTVLSGSKVPHVFALSLFDDYIYWSDWNLKAIVRANKFHGANYTVL
                     RNTTHRPYDLHINHPLRQLPYTNPCGTNNGGCSHLCLIAPPPESTYLNIEGYIEEGAP
                     IFKCACPNQFYLARDMKTCVANCTAGQHLCGGRDEKCIPWFWKCDGEKDCKDGSDEPA
                     TCAPRHCRAGTFQCKNTNCTPSATICDGVDDCGDRSDEQNCDLPCPLSDFKCKSSGRC
                     ILDSWRCDGDADCKDGSDEDPAVCFKRTCDPKTEFSCKNGRCIPQLWMCDFDNDCGDD
                     SDEPAYMCRQRNCTTGWQRCPGQSNYRCIPKWLFCDGKDDCRDNSDELPENCPKCNPE
                     TDFKCGNNRCIPKQWMCDFADDCGDASDENEAVCKGRYRECSESEFRCGNGKCISSRW
                     QCDHEDDCGDNSDEMHCEGYQCKNGTFQCASGHCIASYFRCDGDRDCRDMSDEVGCPP
                     RFPGGRYCPESRFQCNNNLCVSLSDLCDGTDDCGDGSDEDPSVCSDFNCDTLRRFQCS
                     NERCVARYQICDGVDNCGDGSDENNMTLCASKQKPCDLYTQYQCANKHCIERSQVCDF
                     SDDCGDASDELGCHHTSSCSEANRGGCQQHCHNLTDGGYICTCYPGYIIAADNKKKCS
                     DVDECLTRQHTCSHQCHNLNGTYSCSCREGFHLTDGASGVCRAEKEDVILLFVNGQEI
                     RGLNWHKSEEFAVIAAEKRIEALDYDAQQQIVFWADSYDKTIKRSYMVNAIDGRAKIG
                     FAQDLNMKGGSKPTAVAVDWLASNLYWTEMDRTGSKPRGRVMVAKTDGRYRRSIVNAG
                     LEVPTSIAVNPQLGRIYWSDAGSAPKIEVSWMDGSKRRPLITEMIRHPAGLTIDYSQD
                     HIIYWVDTKLNAIESMRADGSRRKAIVRGDQLRHPVSLDLFESNMFWMTRDTGELVRQ
                     DKFGRGVQVVLHRYIVNPSGLKVYHDKRYNTSLPNPCDNSTCSHLCLLVPGGHRCACP
                     DASGPPPSHRSTAEVICNAAAEHPRPAPRICPCQNGGLCKEDAQGELLCECRTQFVGE
                     HCETSTMGAFGHGDANVTAVVVPIMVILLVMMAAAGAWYVIRKRPFGKLARMPAMTSS
                     QSVTFRHGSNVEFNESGFPGASAPGAGDVAPIEGYNLQTVNANKARDFANPMYDAVQS
                     GTTADPGMGNGSGIYDVPGEPSAKVKSMGHHAGGSFTEPASAIIAPSSITHKASPQLQ
                     LRTRELDPSADTGKDTQFLVEEDKSEC"
     misc_feature    966..1064
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(981..983,1005..1007,1038..1043)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1017..1019,1026..1028,1038..1040,1056..1061)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1047..1061
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1107..1205
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1122..1124,1140..1142,1173..1178)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1152..1154,1161..1163,1173..1175,1191..1196)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1182..1196
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1371..1478
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1386..1388,1413..1415,1446..1451)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1425..1427,1434..1436,1446..1448,1464..1469)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1455..1469
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1491..1595
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1506..1508,1530..1532,1563..1568)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1542..1544,1551..1553,1563..1565,1581..1586)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1572..1586
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1608..1733
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1623..1625,1665..1667,1698..1703)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1677..1679,1686..1688,1698..1700,1716..1721)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1707..1721
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    <1836..1961
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cl00057"
                     /db_xref="CDD:469594"
     misc_feature    <1971..2399
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="DNA-binding beta-propeller fold protein YncE
                     [General function prediction only]; Region: YncE; COG3391"
                     /db_xref="CDD:442618"
     misc_feature    2214..>2645
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    2214..2327
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    2343..2459
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    2466..2576
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    2784..2912
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    3057..>3473
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Sugar lactone lactonase YvrE [Carbohydrate
                     transport and metabolism]; Region: YvrE; COG3386"
                     /db_xref="CDD:442613"
     misc_feature    3261..3389
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    3414..3518
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    4059..4166
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: Ldl_recept_a; pfam00057"
                     /db_xref="CDD:395011"
     misc_feature    order(4077..4079,4101..4103,4134..4139)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4113..4115,4122..4124,4134..4136,4152..4157)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4143..4157
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4176..4274
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(4194..4196,4218..4220,4251..4256)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4230..4232,4239..4241,4251..4253,4269..4274)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4260..4274
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4299..4406
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4314..4316,4341..4343,4374..4379)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4353..4355,4362..4364,4374..4376,4392..4397)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4383..4397
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4419..4526
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4434..4436,4461..4463,4494..4499)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4473..4475,4482..4484,4494..4496,4512..4517)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4503..4517
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4563..4658
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4566..4568,4593..4595,4626..4631)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4605..4607,4614..4616,4626..4628,4644..4649)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4635..4649
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4668..4766
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(4686..4688,4710..4712,4743..4748)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4722..4724,4731..4733,4743..4745,4761..4766)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4752..4766
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4800..4904
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(4818..4820,4848..4850,4881..4886)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4860..4862,4869..4871,4881..4883,4899..4904)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4890..4904
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    5061..5156
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    5370..5492
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    5496..5630
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    5565..5684
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    5631..5759
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    6453..6608
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    6948..>7034
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    7272..7412
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    7473..7595
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    7551..7673
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    8232..>8630
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    8274..8363
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    8397..8531
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    8508..8636
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    9096..9200
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9111..9113,9135..9137,9168..9173)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9147..9149,9156..9158,9168..9170,9186..9191)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9177..9191
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9213..9320
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9228..9230,9252..9254,9285..9290)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9264..9266,9273..9275,9285..9287,9309..9314)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    order(9294..9299,9306..9314)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9345..9446
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9360..9362,9387..9389,9420..9425)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9399..9401,9408..9410,9420..9422,9438..9443)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9429..9443
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9597..9695
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(9615..9617,9639..9641,9672..9677)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9651..9653,9660..9662,9672..9674,9690..9695)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9681..9695
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9735..9842
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(9744..9746,9786..9788,9819..9824)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9798..9800,9807..9809,9819..9821,9837..9842)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9828..9842
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9879..9974
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9894..9896,9918..9920,9951..9956)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9930..9932,9939..9941,9951..9953,9969..9974)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9960..9974
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10005..10109
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(10020..10022,10044..10046,10077..10082)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10056..10058,10065..10067,10077..10079,10095..10100)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10086..10100
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10125..10223
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(10143..10145,10167..10169,10200..10205)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10179..10181,10188..10190,10200..10202,10218..10223)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10209..10223
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10272..10358
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    10374..10484
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    10581..10679
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    10713..10841
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    10899..11030
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    10989..11105
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11103..11231
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11316..11474
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    11484..11585
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(11499..11501,11529..11531,11562..11567)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(11541..11543,11550..11552,11562..11564,11580..11585)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    11571..11585
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    11610..11714
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(11625..11627,11649..11651,11682..11687)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(11661..11663,11670..11672,11682..11684,11700..11705)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    11691..11705
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    11724..11822
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(11739..11741,11766..11768,11799..11804)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(11778..11780,11787..11789,11799..11801,11817..11822)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    11808..11822
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    11847..11948
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(11868..11870,11892..11894,11925..11930)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(11904..11906,11913..11915,11925..11927,11943..11948)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    11934..11948
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    11976..12080
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(11991..11993,12024..12026,12057..12062)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12036..12038,12045..12047,12057..12059,12075..12080)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12066..12080
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12108..12200
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12120..12122,12144..12146,12177..12182)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12156..12158,12165..12167,12177..12179,12195..12200)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12186..12200
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12234..12338
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12249..12251,12273..12275,12306..12311)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12285..12287,12294..12296,12306..12308,12324..12329)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12315..12329
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12351..12455
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12366..12368,12390..12392,12423..12428)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12402..12404,12411..12413,12423..12425,12441..12446)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12432..12446
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12483..12578
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12498..12500,12522..12524,12555..12560)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12534..12536,12543..12545,12555..12557,12573..12578)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12564..12578
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12624..12710
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12624..12626,12648..12650,12681..12686)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12660..12662,12669..12671,12681..12683,12699..12704)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12690..12704
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12753..12848
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12759..12761,12783..12785,12816..12821)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12795..12797,12804..12806,12816..12818,12834..12839)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12825..12839
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12984..13079
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Calcium-binding EGF-like domain; Region: EGF_CA;
                     smart00179"
                     /db_xref="CDD:214542"
     misc_feature    order(12984..12986,12993..12995,13035..13037)
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    13323..>13775
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    13368..13505
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    13545..13670
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    13617..13748
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    13623..13763
                     /gene="mgl"
                     /locus_tag="Dmel_CG42611"
                     /old_locus_tag="CG12139"
                     /old_locus_tag="CG12654"
                     /old_locus_tag="Dmel_CG12139"
                     /old_locus_tag="Dmel_CG12654"
                     /old_locus_tag="Dmel_CG34339"
                     /old_locus_tag="Dmel_CG34352"
                     /gene_synonym="anon-WO0140519.108; CG12139; CG12654;
                     CG15316; CG34339; CG34352; CG42611; CT7830; Dm CG34352;
                     Dmel\CG42611; LDLR; LRP-2; lrp2; megalin; Mgl; SOSIE"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
ORIGIN      
        1 cgtcgtcgtg aacggtcagc cagcgcggct aataagtaac caactgtagt gacagtgcga
       61 tagtgactct gatccgaacc cgaatcccag gcccacaaca gatacgtcca gcgtgtgggc
      121 agccagaaca gagtgacaag aatatcggag ccgacaacaa cagtaaactg aaagatagaa
      181 agaaagaaag aaaggccaac ctgccgatta aattccaatt gagtgttacg agtttttttt
      241 tcgagtgagt gcggcgccca ccaaaagaaa aaaataaata ttccaaaaag taaaacgcaa
      301 caaagccaga ggagcgggca accctaaaaa agacagaagt gcggtgggca gagaagaggt
      361 caccagaggg tcaccaaaaa aaacaaaaaa aaaccgaaac gaacaagacc caaatccgaa
      421 tcgaggattc ccacagaaac caaacaggaa aaggagaaag gagcggagca gcaagcgaag
      481 cgcccgacga accaaaaatg aatccgacgc ccgtgggcat tggattcgga tttggtcgca
      541 agccgcccag caaggccaga atgcgttctc gctggcgacc accatcagcg acaaccctgc
      601 tgacccatga ccccgccaac ggcgacagcc atacggccgc cgatccgctg caggtcactg
      661 atgccgcccc atcgggccca ccatcatctt catcatcctc gcccatcggc gaccgccatt
      721 cacagcatca cagcagcagc gccatcgatc ggaggctgca gcagcagcag caccaccaat
      781 caccgcagca ccatcgtcag cgcggccagt tgacaaccct ggcgctgctg ctactggccc
      841 ttgtggccat cagcaacctg gaaaccctgc tcgccgtgcg caccgaagga ccgcgcaacc
      901 gtcatggatc accaggtggc agcctggcca gcacaggtgg cagcagcagt ggcatcaaca
      961 cggagtgtcc aacggactcg tttcgatgca acaatggcaa gtgcatctcg caccactggg
     1021 tctgcaatta tcaaaaggac tgcgacgatg gcgaggatga gatgcagtcg tgccctccac
     1081 cggaatgcga aacgccgcag ttgaattgcg ggcagtacac gttcaacaag acctactgca
     1141 tccctccgca ctatcgctgc gatatgatcg aggattgtga ggacaaatcg gatgaggcgc
     1201 agtgcacgta ccgcaagtgc cagcacacgg acttgttttg caacacgccc actggagcac
     1261 cggcggaggg cgcccgcctc accggaccct gtgtgcccaa ggagaagcgc tgcgacggct
     1321 acttggactg ccgcaccggg cgggatgagg tcggctgcag tggcgtagcc tgtcgcctcg
     1381 accagttccg ctgtgccaac ggactcaagt gcatcgacgc cgccctgaag tgcaatcacc
     1441 gcgatgattg tggcgacaac tctgacgagc agggatgcaa cttcccgcca tgccaccacg
     1501 cccagttccg ttgcacgaac gcactgtgca taccgtacaa ctttcattgc gatggctacc
     1561 acgactgcgc cgacaagagc gacgaggcca actgcacggc catcgcctgt ccggacaaca
     1621 agcacctctg tccacgtggc ggcgccagcg gcacgcccaa gtgcatcctg aagtcgcaac
     1681 tctgcgacgg caagcgggac tgcgaggatg gaagcgatga ggagaccaac tgctctattg
     1741 cctcatgccc cgccctgagc tgtgagttca aatgcggacc ctcgctgacg ggtggagtgt
     1801 gctactgtaa gccgggccaa tcgctggctc ctgacaaccg gacctgtgtc gacctggacg
     1861 agtgcgcgga atggggtcac tgcgaccagc tgtgcaccaa cacactggga tcgtatacat
     1921 gccaatgcgc ccagggctac acgctcatca acgactccaa gtgcatagct ccggatgcga
     1981 ataacttgca actgatattc gcccacgatc gtgccatcat gcgaatgctg ccgcatggca
     2041 gtgagcccaa gattttggcc aatgcaactg ccgcggcggg tgtgaccttc cattatgccc
     2101 ggaacacact gtactggtcg gacatcaaga cgaggaaggt tcaatcactg ccgctggatg
     2161 cgcagaacaa ggccgtctcg cccttcgatc agacccttcc cggcacctgg gcgcccgtcg
     2221 ctctggccgt cgactgggtg ggcgataaga tatatgtggc ggatttggtg ggtcagaaga
     2281 tcgatgtctt cgagctgagt ggtcaatggc atgcggttgt tctgggctct aatctcacct
     2341 cacccgccga tctggcactg gatcccacgg ctggtctaat gttcgttgcg gatggcggtc
     2401 aggtgctccg tgcccatatg gatggcacac atgccagatc gattgtctcg gaggcggcct
     2461 acaaggccag cggtgtgacg gtggacatta tcagcaagcg tgtcttctgg tgcgactccc
     2521 tgctggacta cattgaatcc gtggactatg agggtgctca tcgggtgatg gtgctcaggg
     2581 gtcaacaggt tccgagtccc tcgcgattgg ctctgttcga gaatcgtatc tactggacgg
     2641 atgccaccaa gcagggcatc atgtcggtgg acaagttcga gggtcccacc tccattcagg
     2701 ttacgtacaa ggccaaggac atcagggagc cgaagggcat cattgctgtt catgcgctca
     2761 gccagcccag agtatcgaat ccctgtggca acaacaacgg tggctgcaat cacatgtgca
     2821 ttgtgaccgc cgtaaaggga gcacccactg gcctgggatt ccgttgtgcc tgctccacgg
     2881 gctaccagct ggaaacggat ctgaaactat gcaagccagt cagtgaattc ctcatgtact
     2941 cgcagcagag attcatcaag ggaaaggtat tggaaccggt aattgaagga tttagtgatg
     3001 ccatcatgcc ggtggtttcg aggcgtgctc gtttcgtcgg tctggatttc gatgcacgcg
     3061 atgagttcat ctactactcg gatgtgctgc aggatgtgat ctacagggtg caccgaaacg
     3121 gaactggccg ggagatcgtc ttggcctctc agaatgaagg cgttgaggga ctggccgtcg
     3181 attgggcctc caagaatctg tactacatcg attcgcgcaa gggcaccttg aacgtcctat
     3241 ccacccgaaa tgtgacacac agaagaaccc tactgaaaaa cctgaaacgt cccagggcca
     3301 ttgtggtcca tcccaatcgt ggtttcatct tcttctccga atgggaccgt cctgcgaata
     3361 tcaccagagc aaacacagat ggtagtggtt tgttggtgtt caaaaatgta accctcggct
     3421 ggccaaatgg actatccatc gacttcaagg aggatcgtgt ctactggtgc gatgctctat
     3481 tggatcacgt tcagcatgcc aacctggatg gcacggatat taagacggtg aactcacgac
     3541 tggtgcgaca tccgttctcc attgtcattc acaacgattg gatgtatatc acggactggc
     3601 gcctggatgc cattatacgt ttgcacaagc ttacgggcga gcaggaggag atgatggtca
     3661 gagagccgca gaccaataga ctgtacggcg ttaaggtgta cagtcatgag gtccagagga
     3721 tcgcggacac gcaaccttgt cacaggaaca atggtggctg ccagaagatc tgtttcgctg
     3781 ttcccatcgg agcatcaaat ggtaccgatg gggtgaccac ttcgtcgccc tcgttcggtc
     3841 gcctacagtc gcgctgctcg tgtccctatg gcgaacgatt ggccgacgac caggtgagct
     3901 gcattcccga tcccagtgcc gagccaccag tgcaaccctg cccgaactca tgggacttta
     3961 cgtgcaacaa tcagaggtgt attcccaagt cgtggctatg cgacggtgat gatgactgtc
     4021 tggataacag tgatgaggag cagaactgca caaagcccac ttgcggatcc aacgagttcc
     4081 agtgtcgatc gggtcgctgt attccgcaga acttccgttg tgaccaggag aacgattgcg
     4141 gtgacaactc cgatgagcag gagtgcggca atgtgacctg tggaacgtcc cagtttgcct
     4201 gtgccaatgg acgctgtatt cccaatatgt ggaaatgcga tagcgagaac gattgtgggg
     4261 atagcagtga tgagggtgac ttctgtgccg aaaagacctg cgcctatttc cagttcacgt
     4321 gcccgcgaac gggtcactgt attccacaga gttgggtttg tgacggcgac gatgattgct
     4381 ttgacaaaca ggacgagaag gattgtccac cgatatcctg tctggcgaat caattcaaat
     4441 gcgcggatct aaggcaatgt gtagaggagt cctacaaatg tgatggcata ccggactgta
     4501 atgatggctc cgatgaggtg ggctgtcctt ccatgggacc aaatcagtgt aacctggaga
     4561 agcacttccg ttgcaagtcc actggcttct gtattcccat cgcctggcac tgtgatggct
     4621 ccaatgattg ttcagatcat tcggatgagc aggattgtgg tcagatcacc tgtgcccaga
     4681 acttcttcaa gtgcaacaac acgaactgtg tatttaaggc atacatatgc gatggcaagg
     4741 acgattgcgg tgataattcg gatgagggag ctgaacacgc atgtgtccca cccccgttca
     4801 agtgtcccca tggtcagtgg cagtgtcctg gcgtttccga gagatgcgtg aacatcacat
     4861 ctgtctgtga tgatacgccc gattgtccca atggttcgga tgagggtgag ggctgcgatt
     4921 tggccgagtg cgaacatcag gcgggtcagt gctctagctt ctgtcagaag acccccaacg
     4981 gtgcgttgtg tgtgtgtcca cctggttcgg agatcggcga agatggctac acctgcatag
     5041 atagcaacga gtgcgatcca ccgggtctct gctctcagca atgtaccaac accaagggct
     5101 cctacttctg ctcctgcaca gatggctatg ttctcgagcc gaataagcac acttgcaagg
     5161 cagtaaacca caccgccgcc ttcctaatca tctcaaatcg tcactccatt cttgtggcag
     5221 atctcaagga acagggactc gagagggtgc ccatcatagt ggaaaatgtg gtggccactg
     5281 cttccaatat gcacacaggc actattttct ggagcgacat gaaactaaag aagatctccc
     5341 gattagatcg cggtatggag ccacaggaaa tcattaacac gggcctagac ttggtcgagg
     5401 gcctggccta tgattggatt gcccagaatc tctactggct ggacagcaaa ctgaacacca
     5461 tcgaagtgtc cgcggagaac ggttccaatc gtctggtttt ggtcagggaa aacatcaccc
     5521 aaccaagagg catgtgcatc gatcccagtc ccggagcaag atggatcttc tggactgact
     5581 ggggagagaa cccaagagtg gagagaattg gcatggatgg tactatgaga aaaacgatca
     5641 tcaataccaa gatctactgg cccaatggct taactttgga tatagcaaca aagagggttt
     5701 actttgccga ctccaagctg gactttattg atttctgcta ctacaacggc accggtagac
     5761 agcaagtcct ggccagtagt cactatctgc tgcatcctca ctcgttgtcc ttgttcgagg
     5821 atacgctcta ctggaccgac aggcaattga atcgagtgtt gtccgccaat aagttccgtg
     5881 gcaagaatca gaccgtcgtt tcccacctga taagtcaacc cttgtccatc cacgttcatc
     5941 acgcttccct gcagcccatg actccgaatc cctgcgccgg atcacgctgc cagcacttgt
     6001 gtctgctgag tcccagtgcc ccggagggtt actcctgtaa gtgcaggccg ggctttaagc
     6061 tcctgagcga aggtcgttgc atcgaggagg agaatccctt cctcatggtc gtcaagggta
     6121 cacaaattgt ggatcttcct ttgaatggtg gcgatgcgag agccggagct ctggccccag
     6181 ttattggaat cgaaagcagc acgggcttgg actttgatcg caaaggagag acgctctact
     6241 gggtgcaggg cagggaggat gatgatgaga actgcaccat ctatacgaca ccctatggtg
     6301 gtggcaataa gacactcttc ctgggtatcg aaaatggaat tgtgggtgca ccctacacca
     6361 ttgcattcga ttggctgggc agaaatcttt acattggcaa ccgggtggcc agcaacattg
     6421 aagccgtgcg cgtggatggc aagcaaaagt atcgcaccat aatcctggcc aacgatggtt
     6481 atcccaactc cgtgtcgcgg cccaaacaaa ttgcactaga tcccaccgaa ggtaagctct
     6541 tctggatcga cgaaggagtt ctggaagtgc ccattaaaat tggcagagtt gatatgaatg
     6601 gacagaatcc cattgtagtc ttccaggagt ttgcccatcc cgaatcgttg gccgtggaca
     6661 cggagaagaa aatggtgtac tacagtgcta gcaatccagc ggtgatcggt gtcatggact
     6721 acaatggtga cgatcataca ctgatcttga tgaaggactc gcatccgatg gccaagccca
     6781 ggagcttggg catcctagac cataggcttt actacctgga tccgttgtac gagcgtattg
     6841 tgaggattga tctgccgcac ggtgataatc ccaagaccat tgtcgacaac gagtccgatc
     6901 tgcggtcgat gatgatctac aagaagcgcg ccctgatgca acatccctgc cagacgaaca
     6961 acggtggctg caagcacctt tgcattcccg gacctggtgc aaccagaacg tgtgcctgcg
     7021 gcattggata cagaaaggaa aacgagatca actgcgtggc gtataagatc tttgccgtgg
     7081 tctcccaact ggacatgatc aggggctata gcttgagcga tagctccgag gcgatggtac
     7141 cgataagcgg acctggccac cacattctcc atgtggatgt gatgtatcgc gagcaatgga
     7201 tctactgggc ggagtacaat cgtggctact ggaatggcat tttcagatcg cgacccaatg
     7261 gcaccgatct gcagcatgtg gtcaaggatg gcatcggcag taatggcatc aggggtttga
     7321 ccatcgattg ggtggccggc aatatgtact tcaccaacgt ctatccccat gagaattatg
     7381 tggaagtttg ctggctggat ggtagcaata ggaaagtgtt ggtgaagaca accacagatg
     7441 caccacgtga actggccgtg aatcccatta agaggctact ctattggatc gactatggcc
     7501 agcatcctag gattggaaaa gccctcttgg atggcagcaa atggacacca ctggtgacat
     7561 cgggcatttc gttgcctcgc gatctaacca ttgacatgca gacccatgac atctactggg
     7621 tggactcgaa actggacacc attcagaaga tttcgtataa tggcgccaat cgcaagataa
     7681 tccgcagaga tctgcccaac cccatgggca ttgctgtcta tctgaacgat gtctactggg
     7741 tggataggaa tctgatgacc gtgttcaagg cctccaagca tagtgccaat gaaactgcca
     7801 ccagcgtgag aacgaatctg gaaaagctta gggacatcgc catatacaac atcaacaatc
     7861 agccgcagga cgatacaaat ccatgtgcgc atttaggaaa cggtggctgt gatcagttgt
     7921 gtttcagttt cccaccggat ggcggagcct ccggtacctc aggaggaagg aatttccgtt
     7981 gcgaatgtgc cactggaaaa ctgagcgccg atgaaagaaa gtgtgaggtg gtcaacgagt
     8041 acctagtctt cgccacaaga actgaaattc gagctgtcaa tcttgatccc cattccacgg
     8101 aagttccctt cactccactg acaaatctca caaatgtcgt gggtctggac tttgattttg
     8161 cccacaaccg aatgctgtat acccaaatcc gtccgtgggc caagattgcg tacaccaagg
     8221 cgaataagcc ggggcacgat gacatcactg tggtcctgaa caagggcatt aatcccgagg
     8281 gcattgccta cgattggacc cagcagaaaa tctactggac tgatagctcg aacaactcga
     8341 tctatgccat gaatttggat ggtagcgaac tggttatgat tgcccgcgtt gaaagaccgc
     8401 gagctattgt cctcgatccc tgcaatggca cgctattctt tacggattgg ggcaggttcg
     8461 gtacgtctgg caagattttc cgcaccacca tggcgggttc cctgaagaga gccattgtcg
     8521 acaaggatct ttcgcagcca agtggcttgg ctatcgatta tgatgagaga cgcctatact
     8581 ggacggatgc ggtgagagag aagatcgaga gatccgatct ggacggtcag aatcgagagc
     8641 ttctggtggc agccaccatt tatccgttcg ccataaccgt gttcaggaac tacatctact
     8701 ggacggatct tcagctgaga ggtgtctata gggctgagaa gcacactgga gccaacatgg
     8761 tggagatggt gaagcgattg gaggattctc cgcgagatat tcgcatctac agttccgatc
     8821 gccaaaagtg caatgtgaat ccgtgcagga tcaacaacgg cggatgtgcc cagagctgtc
     8881 atcctgcccc gaatggcaag gccgagtgca agtgcgacga tagcaccaag gtggtgaacg
     8941 agggaaggat gtgtgccccg cgaaacaata cttgcgaggc cagcaaattc tactgcaaga
     9001 acggcagatg catttcgaga atgtggtcct gcgatggcga cgacgactgt ggcgacaact
     9061 ccgacgagga tcccaactat tgtgcctatc actcctgctc ccccaacgag ttccgctgca
     9121 acaacggacg ctgcatcttt aagtcgtgga agtgtgatca cgagaacgac tgcaaggatg
     9181 gttccgatga gctgggctgc gtctatccac catgtgtgga tggtgagttc acttgcgcca
     9241 atggacggtg tattccacag gctcaggtgt gcaatggtgt gaatgactgc aaggataatg
     9301 ccacatcgga tgaaacgcac gaacggtgtc ccatgaacac cacttgtccg gcgaatcatc
     9361 tgaagtgcga gaagaccaac atctgcgtgg aaccctattg gttgtgcgat ggcgacaacg
     9421 attgtggtga caactccgac gaggatccac tgcattgtgg ccaacgaact tgtccaacca
     9481 acagtttccg gtgtcccaac caccgatgca ttccagctac ctggtactgt gatggtgacg
     9541 atgactgtgg cgatggagcc gatgaaccac cagattactg caaatcggaa ggacgcacat
     9601 gcttcgggga tctgttcacc tgcgacaatg gcaactgcat accaaggatc tacatctgcg
     9661 atggcgacaa cgattgtttg gacaacagtg acgaggataa ccggcaccag tgcaatgacc
     9721 gtaagtgtga tgaggaaacg gagttcactt gtgtggagaa caaatcctgg cagcgtgccc
     9781 agtgcatacc caaaaaatgg atctgcgatg gtgatccgga ttgcgttgac ggagccgatg
     9841 agaatactac tctgcacaat tgtgccaccc agcagccctg tggcgaggat atgttcacct
     9901 gtggcaatgg acgttgcatc aataagggat ggatctgtga ccatgacaac gattgcggcg
     9961 atggtaccga tgaaggcaaa ttctgtaact ccaagtacaa gacctgttcg gcccaggagt
    10021 tcacctgcca gaacttcaag tgcatccgaa atcaatcccg gtgcgatggc gaagacgact
    10081 gcggtgatca ctcggatgag gtgggctgtg ccaaggagaa cataacctgt ccacagggtc
    10141 agttcgcctg tacgaatggt cagtgcatcg actacaatct ggtgtgcaac aagtatccgg
    10201 attgtgccga cgagtccgac gaacctgccc attgcaacgt ggatgagtgc gccaaggtgg
    10261 agatcaatca gtgtggccac aagtgcgtgg acacgctgac aggttactac tgcgactgca
    10321 atgagggcta caaactgcta gccgatggca aagcctgtgc ggatgtggat gagtgcctag
    10381 agcagccggg cgcttgttct cagcactgtt ccaatacccc gggtggattc tactgcaagt
    10441 gcgacgagac ctactacgaa aggcagaacg atgagcacac gtgcaagcgt aaggacaaga
    10501 tcccaccgtg gctgatcttc accaacaagt actatgtgcg caatatgtcg gtggatggac
    10561 atcagtacaa tcttatgcac caggatctga tgaatgtggt ggctctcgac ttcgatatac
    10621 gcgaggaata catgtacttc tgtgatgtca cggccaagac catcttcaga gcgaagtatg
    10681 gagaggccga tgacgagatg ccgccggaga gggaggctgt catcaggcac gattcccatg
    10741 gcctggaggg catcgccatc gattgggtgg gtcgcaaact gtactggctg gacaggcact
    10801 ccaagaacct ggatgtctcc gaattggacg gcagcaagcg caagacactg agaagtggcg
    10861 tcgtcgatcc gcgtgccatc gtcgtgcatc ctggtatcgg ttacctgtac ttcacctcct
    10921 ggcatctgca agcctatatt gccaaaatgg gcatggatgg ttcgaacttc tcgagaattc
    10981 taaactggaa cgatggcatc gcctggccga atgctctgtc cattgattac ttcacggatc
    11041 gaatttactg ggcagatgct cacttggact acatagcata tgctgatctg gagggcagac
    11101 atcgtcatac ggtgctctca ggaagcaagg tgcctcatgt gttcgcactg agtctcttcg
    11161 acgactacat ctactggagt gactggaatt taaaggcgat cgtgagggcc aacaagttcc
    11221 atggtgcgaa ctatacggtg ctgaggaata ccacccatcg accgtatgac ctgcacatca
    11281 atcatccgct gagacagttg ccctacacca atccgtgtgg cacaaacaat ggcggttgct
    11341 cacatctctg cctgattgct ccgccgccgg aatccaccta tctgaacatc gagggatata
    11401 tcgaggaggg tgcaccaatc ttcaagtgtg cctgtcccaa tcaattctat ttggccagag
    11461 acatgaagac ctgcgtggcc aactgtacgg ccggacagca tttgtgtggc ggacgagatg
    11521 agaagtgcat cccatggttc tggaagtgcg acggtgagaa ggactgcaag gatggctccg
    11581 atgagcccgc tacctgcgct cctcgacact gccgtgctgg aacgttccag tgcaagaaca
    11641 ccaactgcac accatcggcg accatttgcg atggagtgga tgactgtggc gatcgcagcg
    11701 atgaacaaaa ttgcgatcta ccctgtccac tatccgattt caagtgcaag tccagcggca
    11761 gatgcatcct cgatagttgg cgctgcgatg gagatgccga ctgcaaggat ggcagcgatg
    11821 aggatccagc cgtctgcttc aagcgaacat gtgatccgaa aaccgagttc tcctgcaaga
    11881 atggccgctg cattccgcaa ttgtggatgt gcgatttcga caacgattgt ggcgacgact
    11941 ccgatgagcc ggcgtatatg tgccgtcaaa ggaactgcac caccggctgg cagaggtgtc
    12001 ccggccagtc caactatcgc tgcattccga agtggctgtt ctgcgatggc aaggacgatt
    12061 gtcgcgacaa cagcgatgag ctgcccgaga actgtcccaa gtgcaatccg gaaacggact
    12121 tcaagtgcgg caacaaccga tgcataccca agcaatggat gtgcgatttc gcggacgatt
    12181 gtggcgatgc cagtgacgag aatgaggcag tgtgcaaagg acgctatcgg gagtgctccg
    12241 aatcggagtt ccgttgcggc aatggcaagt gcatatcatc ccgctggcag tgtgaccacg
    12301 aggacgactg tggcgataac tcggacgaga tgcactgcga gggataccag tgcaagaatg
    12361 gcaccttcca gtgcgcttcc ggtcactgta ttgcctccta cttccggtgc gatggcgatc
    12421 gcgactgccg cgacatgtcc gatgaggtgg gctgtccgcc cagattcccc ggcggtcgct
    12481 attgtcctga atcgcgtttc cagtgcaaca acaacctgtg cgtttcgctg tccgatttgt
    12541 gcgacggcac cgatgattgc ggcgatggca gtgacgagga tcccagcgtt tgcagtgact
    12601 ttaactgcga taccctgcga cgattccagt gctccaatga gcgctgcgtg gcccgctatc
    12661 agatctgcga tggcgtggac aactgcggcg atggcagcga tgagaacaac atgaccctat
    12721 gtgccagcaa acagaagccc tgcgatctgt acacgcagta ccagtgtgcc aacaagcatt
    12781 gcatcgagcg gtcccaggtg tgtgatttct ccgacgattg tggcgatgct agtgatgagt
    12841 taggatgcca ccacacgagc agttgctccg aagcgaatcg gggtggatgc cagcagcatt
    12901 gccacaatct aacggatggt ggatacattt gcacctgcta tccgggctac atcatagccg
    12961 ccgacaacaa gaagaagtgc tccgacgtgg acgaatgcct gacgcgacag cacacgtgct
    13021 cccaccaatg ccacaatctg aatggcacct actcgtgcag ttgtcgcgaa ggattccatc
    13081 tgacggacgg cgccagcggc gtatgccgtg ccgaaaagga ggatgtcatt ctcctgtttg
    13141 ttaatggtca ggagatcaga ggtctgaatt ggcataagag cgaggagttc gctgtgatag
    13201 cggcggagaa gaggatcgag gcactggact acgatgcgca gcaacagatc gtcttctggg
    13261 cggatagcta tgacaagacc atcaagcgat cctacatggt caatgccatc gatggcaggg
    13321 ccaagatcgg attcgcccag gacctgaaca tgaagggcgg ctcgaagccc actgctgtgg
    13381 ctgtggactg gctggcctcg aatctctact ggaccgaaat ggacaggacg ggctcgaagc
    13441 cgcgtggacg tgtcatggtg gccaagaccg atggtcgcta tcgtcgctcg atcgtgaatg
    13501 ctggactcga ggtacccacc tcgattgctg tgaatccgca gctgggcaga atatactggt
    13561 cggatgcggg atcagctccc aaaatcgagg tatcctggat ggatggctct aagcgccgcc
    13621 cactgatcac cgagatgata cgacatcccg ccggcctgac catcgactac tcgcaggatc
    13681 acatcatata ctgggtggac accaagctga atgccatcga atcgatgaga gccgacggct
    13741 cgcgccgaaa ggccattgtg cggggcgatc aactgaggca tccggtgtct ctggatctct
    13801 tcgagtcgaa catgttctgg atgacccgcg atacgggtga gctggtgcgc caggataagt
    13861 tcgggcgcgg agtgcaggtg gtgctgcatc gctatatcgt caatccgtcc ggcctgaagg
    13921 tgtaccacga caagcggtac aacacctcgc tgcccaatcc gtgcgacaac tccacctgct
    13981 cccacctgtg cctgctggtg ccgggcggcc atcgttgtgc ctgtccagac gcctctggac
    14041 cgccgccctc gcaccgcagc accgccgagg tcatctgcaa tgctgccgcc gagcatccgc
    14101 gcccggctcc gcgaatctgc ccctgccaga atggtggact ctgcaaggag gacgcccagg
    14161 gtgaactgct gtgcgagtgc cgaacccagt tcgttggcga gcactgcgag acaagcacga
    14221 tgggagcctt tggccatggt gacgctaatg tcaccgccgt cgtggtgccc atcatggtca
    14281 tcctgctggt gatgatggcc gccgctggcg cctggtatgt catccgcaag cgaccatttg
    14341 gcaagctggc tcgcatgccg gcgatgacct cgtcgcagag cgtgaccttc cgtcacggtt
    14401 cgaatgtgga gttcaacgag agcggcttcc caggagcatc tgcgccggga gctggcgatg
    14461 tggcgcccat cgagggctac aacctgcaga cggtgaacgc gaacaaggcg cgcgactttg
    14521 ccaatcccat gtacgatgca gtccaatcgg gcaccaccgc cgatccgggc atgggcaatg
    14581 gttcgggcat ttatgatgtg cccggcgagc cgtcggccaa ggtcaagtcc atgggccacc
    14641 atgcgggcgg ttcgttcacg gaacccgcct cggcgatcat cgcgcccagc agcattacgc
    14701 acaaggcgtc gccgcagctg cagctgcgca ccagggagct agatccttcg gcggacaccg
    14761 gcaaggacac gcagttcctg gtggaggagg ataagtccga gtgctgatat caagcccgtc
    14821 aatcggctgt cgttgcggcg gcagttgcga tggccagttg ccgccaacag cgccggcagc
    14881 atcagcagca gcagcatccc gagaacagct atccgctgca gacataacac atactggtca
    14941 agcagaggag ggagcagcat cagaagcagc agcatcagca acagcagcaa catcagcagc
    15001 agggacaggg acgttctagt agtaaacatc acaaatcctg gcaggtagcc accgctggca
    15061 aggtcaccac caaggtctag ccgtgacccc aacagaaaac acacaccacc cacagagagt
    15121 agcaacacga tcaggaggag aagatgcagg aggaggagga gaaggatcag cagaaggagg
    15181 agtagcaagt cctcggggac tggggacgcc aataagcaaa catatccaaa aattgataaa
    15241 catatgcaac cccccacagg agaaaccaac taaaaacaaa aaaaaaaaaa ctgttgcaat
    15301 tattattaaa taattactaa aaacaaaact ataaatgtac acaaaacact aagagagcaa
    15361 cacagcaact tttgtaaagc caatttttgt agcccactgt tctttttttt gtttttttgt
    15421 aatttttgtg cgaaactaat gttttttgct aatcgagata cttttgcgca aaacaggagg
    15481 attgtaaaaa gcaagcaaaa atgataaacg aaacaaaatt aaggcaagaa gtatattttt
    15541 ttgaaagcta aatgacaata ttaactatat atgtatgtaa atcggaaaac aaaatatcta
    15601 tatgtataca caaggcaatt aggggacgat tcccagctag gatttctata tatttttcta
    15661 aaaaataaca aacaaaaaaa agcgagctaa aaaatataca acaacaaatt atatatgtat
    15721 gtatatatat atatatatgt gtgaacctaa atgtatcgag cgaaagagca aaaacttttg
    15781 tgctaaatcc aggatagaaa acaagcattc cccattcccc acacacacac acatatgtat
    15841 atctattaat tataattata attataattt aattatttat tcaaacacac acagacagga
    15901 cagacaggaa agtgctaata atccagaata ccaggggctt ttccgcattt ccaattcgca
    15961 atacattcca aaaacaaaag atacgtgcaa tcccctcccc ccgccaaccg cctacactgt
    16021 gcaacaaaga aaagcgtagc ttttcctttc tcccgttttt ttattttttt tttttttttg
    16081 gttctcgcgc aacccgatct gcttttctat ttttctctat tttattacgt tttgtgtgtg
    16141 tagttgcaac ttgtcgcgcg tgttttttac acaccatata taaatatata aatattttat
    16201 tttttaatta tatcatcgat ttatgaattg tattatgatt tatgatttat ctttctcttc
    16261 gaaagtcgaa atgtgtgtgc attttttttt tcattttcgt tctctgtgca aaatctgtgc
    16321 ttcccttcat ttaagcgtgt tttagcataa attttagtga aagatgagag aaactaaagc
    16381 tgtatacgcc aatcgggcca tatacaacgc tatatgtgaa gttaattgta tatttaatgt
    16441 caagctacat aatggataac gaaaaagaaa accagaacat aataagagta aaactacgaa
    16501 tgaaatgaaa aaaaaaacta tttgttgaaa gaataaaact tttttttatt attatacata
    16561 cggggggaaa attgtaagat gaagaaaact aaaacattca ataaagaaaa atcataaaaa
    16621 aatgt