Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NG_049777 789 bp DNA linear CON 08-JUN-2016 D beta-lactamase OXA-50, complete CDS. ACCESSION NG_049777 VERSION NG_049777.1 DBLINK BioProject: PRJNA313047 KEYWORDS RefSeq. SOURCE Pseudomonas aeruginosa ORGANISM Pseudomonas aeruginosa Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas. REFERENCE 1 (bases 1 to 789) AUTHORS Girlich,D., Naas,T. and Nordmann,P. TITLE Biochemical characterization of the naturally occurring oxacillinase OXA-50 of Pseudomonas aeruginosa JOURNAL Antimicrob. Agents Chemother. 48 (6), 2043-2048 (2004) PUBMED 15155197 REFERENCE 2 (bases 1 to 789) CONSRTM NCBI Refseq Project TITLE Direct Submission JOURNAL Submitted (07-JUN-2016) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AY306130.1. This record has been chosen as a reference for antimicrobial resistance. For more general information: http://www.ncbi.nlm.nih.gov/pathogens/ COMPLETENESS: not full length. FEATURES Location/Qualifiers source 1..789 /organism="Pseudomonas aeruginosa" /mol_type="genomic DNA" /db_xref="taxon:287" /clone="GW-1" /geo_loc_name="South Africa" gene 1..789 /gene="blaOXA" /locus_tag="A7J11_00256" /allele="blaOXA-50" CDS 1..789 /gene="blaOXA" /locus_tag="A7J11_00256" /allele="blaOXA-50" /EC_number="3.5.2.6" /codon_start=1 /transl_table=11 /product="oxacillin-hydrolyzing class D beta-lactamase OXA-50" /protein_id="WP_003099707.1" /translation="MRPLLFSALLLLSGHTQASEWNDSQAVDKLFGAAGVKGTFVLYD VQRQRYVGHDRERAETRFVPASTYKVANSLIGLSTGAVRSADEVLPYGGKPQRFKAWE HDMSLRDAIKASNVPVYQELARRIGLERMRANVSRLGYGNAEIGQVVDNFWLVGPLKI SAMEQTRFLLRLAQGELPFPAPVQSTVRAMTLLESGPGWELHGKTGWCFDCTPELGWW VGWVKRNERLYGFALNIDMPGGEADIGKRVELGKASLKALGILP" CONTIG join(AY306130.1:1..789)