Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Pseudomonas aeruginosa PAO222 catB7 gene for type B-4


LOCUS       NG_047614                739 bp    DNA     linear   CON 08-JUN-2016
            chloramphenicol O-acetyltransferase CatB7, complete CDS.
ACCESSION   NG_047614
VERSION     NG_047614.1
DBLINK      BioProject: PRJNA313047
KEYWORDS    RefSeq.
SOURCE      Pseudomonas aeruginosa
  ORGANISM  Pseudomonas aeruginosa
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Pseudomonadales; Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 739)
  AUTHORS   White,P.A., Stokes,H.W., Bunny,K.L. and Hall,R.M.
  TITLE     Characterisation of a chloramphenicol acetyltransferase determinant
            found in the chromosome of Pseudomonas aeruginosa
  JOURNAL   FEMS Microbiol. Lett. 175 (1), 27-35 (1999)
   PUBMED   10361706
REFERENCE   2  (bases 1 to 739)
  CONSRTM   NCBI Refseq Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUN-2016) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF036933.1.
            This record has been chosen as a reference for antimicrobial
            resistance. For more general information:
            http://www.ncbi.nlm.nih.gov/pathogens/
            COMPLETENESS: not full length.
FEATURES             Location/Qualifiers
     source          1..739
                     /organism="Pseudomonas aeruginosa"
                     /mol_type="genomic DNA"
                     /strain="PAO222"
                     /db_xref="taxon:287"
     gene            101..739
                     /gene="catB7"
                     /locus_tag="A7J11_00511"
     CDS             101..739
                     /gene="catB7"
                     /locus_tag="A7J11_00511"
                     /EC_number="2.3.1.28"
                     /codon_start=1
                     /transl_table=11
                     /product="type B-4 chloramphenicol O-acetyltransferase
                     CatB7"
                     /protein_id="WP_003112709.1"
                     /translation="MGNYFESPFRGKLLSEQVSNPNIRVGRYSYYSGYYHGHSFDDCA
                     RYLMPDRDDVDKLVIGSFCSIGSGAAFIMAGNQGHRAEWASTFPFHFMHEEPVFAGAV
                     NGYQPAGDTLIGHDVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPART
                     IRKRFSDGDIQNLLEMAWWDWPLADIEAAMPLLCTGDIPALYRHWKQRQATA"
CONTIG      join(AF036933.1:77..815)