Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS NG_047614 739 bp DNA linear CON 08-JUN-2016 chloramphenicol O-acetyltransferase CatB7, complete CDS. ACCESSION NG_047614 VERSION NG_047614.1 DBLINK BioProject: PRJNA313047 KEYWORDS RefSeq. SOURCE Pseudomonas aeruginosa ORGANISM Pseudomonas aeruginosa Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas. REFERENCE 1 (bases 1 to 739) AUTHORS White,P.A., Stokes,H.W., Bunny,K.L. and Hall,R.M. TITLE Characterisation of a chloramphenicol acetyltransferase determinant found in the chromosome of Pseudomonas aeruginosa JOURNAL FEMS Microbiol. Lett. 175 (1), 27-35 (1999) PUBMED 10361706 REFERENCE 2 (bases 1 to 739) CONSRTM NCBI Refseq Project TITLE Direct Submission JOURNAL Submitted (07-JUN-2016) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AF036933.1. This record has been chosen as a reference for antimicrobial resistance. For more general information: http://www.ncbi.nlm.nih.gov/pathogens/ COMPLETENESS: not full length. FEATURES Location/Qualifiers source 1..739 /organism="Pseudomonas aeruginosa" /mol_type="genomic DNA" /strain="PAO222" /db_xref="taxon:287" gene 101..739 /gene="catB7" /locus_tag="A7J11_00511" CDS 101..739 /gene="catB7" /locus_tag="A7J11_00511" /EC_number="2.3.1.28" /codon_start=1 /transl_table=11 /product="type B-4 chloramphenicol O-acetyltransferase CatB7" /protein_id="WP_003112709.1" /translation="MGNYFESPFRGKLLSEQVSNPNIRVGRYSYYSGYYHGHSFDDCA RYLMPDRDDVDKLVIGSFCSIGSGAAFIMAGNQGHRAEWASTFPFHFMHEEPVFAGAV NGYQPAGDTLIGHDVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPART IRKRFSDGDIQNLLEMAWWDWPLADIEAAMPLLCTGDIPALYRHWKQRQATA" CONTIG join(AF036933.1:77..815)