Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_714087 930 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_714087 VERSION XM_714087.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 930) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 930) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 930) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 930) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 930) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 930) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_714087.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..930 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>930 /locus_tag="CAALFM_C603320WA" /db_xref="GeneID:3639198" CDS 1..930 /locus_tag="CAALFM_C603320WA" /note="Stationary phase enriched protein; Gcn4-regulated; induced by amino acid starvation (3-AT), benomyl or in azole-resistant strain that overexpresses MDR1; flow model biofilm induced; rat catheter biofilm repressed; overlaps orf19.5621" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_719180.2" /db_xref="CGD:CAL0000186816" /db_xref="GeneID:3639198" /translation="MPRIKQVDVFTNVKYLGNPVAVIYDSDNLTTQEMQKIARWTNLS ETTFILTPKSSIADYSIRIFTSGGNELPFAGHPTLGTAFALLEDGKIKPNDNGQIIQE CGAGLVKISVEKTPNNNSNNNNNNSNELPFLLSFQLPYFKFHEIDDKVIEELQHSWNG TNIIGKPVLIDAGPKWAVFQLGSGKEVLDLNVDLAQIERLSLENGWTGIGVFGKHNEN GDSVELRNIAPAVGVAEDPACGSGSGAIGAYLANHVFNEKEKFTIDISQGKPIERGAK IQVKVNRLSTKNGDLSIHVGGHAITCFEGTYSI" misc_feature 7..927 /locus_tag="CAALFM_C603320WA" /note="Predicted epimerase YddE/YHI9, PhzF superfamily [General function prediction only]; Region: YHI9; COG0384" /db_xref="CDD:440153" ORIGIN 1 atgccaagaa ttaaacaagt tgatgtattc accaatgtca aatatttggg taatccagtt 61 gccgttattt atgatagtga taatttaacc actcaagaaa tgcaaaaaat tgctcgatgg 121 acaaatttat cagaaacaac atttatattg actccaaaat catcaattgc tgattatagt 181 attagaattt tcacttctgg tgggaatgaa ttaccatttg ctggtcatcc tactttaggt 241 actgcatttg cattattgga agatggtaaa ataaaaccaa atgacaatgg acaaataatt 301 caagaatgtg gtgctggatt agtgaaaata tccgttgaaa aaacacctaa taataatagt 361 aataataata ataataatag taatgagttg ccgtttttgt tatcttttca attaccatat 421 ttcaaatttc atgaaattga tgacaaagta attgaggaat tacaacattc atggaatgga 481 accaatatta ttggtaaacc ggtacttatt gatgctggtc caaaatgggc agttttccaa 541 cttggctccg gtaaagaagt attagacttg aatgttgatt tagcacaaat tgagcgatta 601 agtttagaaa atggttggac aggaattggt gtctttggaa aacataatga aaatggtgat 661 tcggtcgaat tgagaaatat tgctcctgct gttggagtcg ctgaagatcc tgcttgcgga 721 agtggatcag gtgctattgg agcatatttg gcaaatcacg ttttcaatga aaaggaaaaa 781 tttacaattg atatttctca aggtaaacca attgaaagag gtgctaagat tcaagttaaa 841 gttaatcgtc ttagcaccaa aaatggtgat ttatctattc atgttggtgg tcatgccatc 901 acttgtttcg aaggtactta ttctatttaa