Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_714082 894 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_714082 VERSION XM_714082.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 894) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 894) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 894) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 894) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 894) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 894) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_714082.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..894 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>894 /gene="AYR2" /locus_tag="CAALFM_C603270CA" /db_xref="GeneID:3639184" CDS 1..894 /gene="AYR2" /locus_tag="CAALFM_C603270CA" /note="Putative NADPH-dependent 1-acyl dihydroxyacetone phosphate reductase; shows colony morphology-related gene regulation by Ssn6p" /codon_start=1 /transl_table=12 /product="Ayr2p" /protein_id="XP_719175.2" /db_xref="CGD:CAL0000201074" /db_xref="GeneID:3639184" /translation="MSPKYALVTGASSGIGYNLAIELSKKGYKVIGCSPQSVLFGQKP LEQEYGVISLPLDVTDIDNIKTVLKKVEEITGGRLDVLYNNAGISISGPAIEIDETQL NKVFQVNVIGQINMTKYFAPLIINAKGTILFTSSVAARVPLSWVSAYNATKAAIDAYA LTLHGEMAPFGVRVHSVITGGVDTAICDGNIKTSLGDSFYDVDGVYESIRSSAMMSRD LNISPEQYAKEVVRDIVSWRDPGFNLYHGARSYFLHWVSRFLPLWLVEFGVQIHFKQR RVLQTIAKLIKVKKSQEKKYV" misc_feature 10..753 /gene="AYR2" /locus_tag="CAALFM_C603270CA" /note="17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs; Region: 17beta-HSD-like_SDR_c; cd05374" /db_xref="CDD:187632" misc_feature order(28..30,34..45,103..105,166..174,253..264,322..324, 400..408,445..447,457..459,544..546,550..558) /gene="AYR2" /locus_tag="CAALFM_C603270CA" /note="NADP binding site [chemical binding]; other site" /db_xref="CDD:187632" misc_feature order(325..327,406..408,445..447,457..459) /gene="AYR2" /locus_tag="CAALFM_C603270CA" /note="active site" /db_xref="CDD:187632" misc_feature order(406..414,427..429,445..447,538..543,559..561, 616..618,625..627,748..750) /gene="AYR2" /locus_tag="CAALFM_C603270CA" /note="steroid binding site; other site" /db_xref="CDD:187632" ORIGIN 1 atgtctccta aatacgcttt agtcactggt gcttcttccg gtattggata taatcttgcc 61 attgaattat cgaaaaaagg ttataaagtc attggatgtt ccccacaact ggttttattt 121 ggtcaaaaac ctttggaaca agaatatggt gtcatatctc tcccattaga cgtcacagat 181 attgataata tcaagactgt tttgaaaaaa gtcgaagaaa taaccggagg aagattagat 241 gtattatata ataatgctgg tatatctatt tcaggtccag caattgaaat tgatgaaaca 301 caattgaata aagttttcca agtcaatgta attggtcaaa ttaatatgac aaaatatttt 361 gctcctttga ttatcaatgc taaaggaact attcttttca caagttctgt tgcagctaga 421 gttcccttaa gttgggttag tgcatataat gccaccaaag ctgccattga tgcctatgcc 481 ttgacgttgc atggggaaat ggcaccattt ggtgtaaggg ttcacagtgt aataaccggt 541 ggggtcgata ctgctatctg tgatggtaat attaaaacat cattaggtga ttcattctat 601 gatgttgatg gtgtttatga atcaatcaga agttcagcaa tgatgagtcg tgatttaaat 661 atatcaccgg aacaatatgc taaagaagtt gtcagagata ttgtctcttg gcgtgatccg 721 ggatttaatt tatatcatgg agccagatct tatttcttgc attgggttag tcgtttcttg 781 ccattatggc ttgttgaatt tggtgttcaa atccatttca aacaacgcag agtattacaa 841 actattgcca aattgataaa agttaaaaaa tcacaggaaa agaagtatgt ataa