Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Ayr2p (AYR2), partial mRNA.


LOCUS       XM_714082                894 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_714082
VERSION     XM_714082.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 894)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 894)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 894)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 894)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 894)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 894)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_714082.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..894
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>894
                     /gene="AYR2"
                     /locus_tag="CAALFM_C603270CA"
                     /db_xref="GeneID:3639184"
     CDS             1..894
                     /gene="AYR2"
                     /locus_tag="CAALFM_C603270CA"
                     /note="Putative NADPH-dependent 1-acyl dihydroxyacetone
                     phosphate reductase; shows colony morphology-related gene
                     regulation by Ssn6p"
                     /codon_start=1
                     /transl_table=12
                     /product="Ayr2p"
                     /protein_id="XP_719175.2"
                     /db_xref="CGD:CAL0000201074"
                     /db_xref="GeneID:3639184"
                     /translation="MSPKYALVTGASSGIGYNLAIELSKKGYKVIGCSPQSVLFGQKP
                     LEQEYGVISLPLDVTDIDNIKTVLKKVEEITGGRLDVLYNNAGISISGPAIEIDETQL
                     NKVFQVNVIGQINMTKYFAPLIINAKGTILFTSSVAARVPLSWVSAYNATKAAIDAYA
                     LTLHGEMAPFGVRVHSVITGGVDTAICDGNIKTSLGDSFYDVDGVYESIRSSAMMSRD
                     LNISPEQYAKEVVRDIVSWRDPGFNLYHGARSYFLHWVSRFLPLWLVEFGVQIHFKQR
                     RVLQTIAKLIKVKKSQEKKYV"
     misc_feature    10..753
                     /gene="AYR2"
                     /locus_tag="CAALFM_C603270CA"
                     /note="17beta hydroxysteroid dehydrogenase-like, classical
                     (c) SDRs; Region: 17beta-HSD-like_SDR_c; cd05374"
                     /db_xref="CDD:187632"
     misc_feature    order(28..30,34..45,103..105,166..174,253..264,322..324,
                     400..408,445..447,457..459,544..546,550..558)
                     /gene="AYR2"
                     /locus_tag="CAALFM_C603270CA"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187632"
     misc_feature    order(325..327,406..408,445..447,457..459)
                     /gene="AYR2"
                     /locus_tag="CAALFM_C603270CA"
                     /note="active site"
                     /db_xref="CDD:187632"
     misc_feature    order(406..414,427..429,445..447,538..543,559..561,
                     616..618,625..627,748..750)
                     /gene="AYR2"
                     /locus_tag="CAALFM_C603270CA"
                     /note="steroid binding site; other site"
                     /db_xref="CDD:187632"
ORIGIN      
        1 atgtctccta aatacgcttt agtcactggt gcttcttccg gtattggata taatcttgcc
       61 attgaattat cgaaaaaagg ttataaagtc attggatgtt ccccacaact ggttttattt
      121 ggtcaaaaac ctttggaaca agaatatggt gtcatatctc tcccattaga cgtcacagat
      181 attgataata tcaagactgt tttgaaaaaa gtcgaagaaa taaccggagg aagattagat
      241 gtattatata ataatgctgg tatatctatt tcaggtccag caattgaaat tgatgaaaca
      301 caattgaata aagttttcca agtcaatgta attggtcaaa ttaatatgac aaaatatttt
      361 gctcctttga ttatcaatgc taaaggaact attcttttca caagttctgt tgcagctaga
      421 gttcccttaa gttgggttag tgcatataat gccaccaaag ctgccattga tgcctatgcc
      481 ttgacgttgc atggggaaat ggcaccattt ggtgtaaggg ttcacagtgt aataaccggt
      541 ggggtcgata ctgctatctg tgatggtaat attaaaacat cattaggtga ttcattctat
      601 gatgttgatg gtgtttatga atcaatcaga agttcagcaa tgatgagtcg tgatttaaat
      661 atatcaccgg aacaatatgc taaagaagtt gtcagagata ttgtctcttg gcgtgatccg
      721 ggatttaatt tatatcatgg agccagatct tatttcttgc attgggttag tcgtttcttg
      781 ccattatggc ttgttgaatt tggtgttcaa atccatttca aacaacgcag agtattacaa
      841 actattgcca aattgataaa agttaaaaaa tcacaggaaa agaagtatgt ataa