Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 ornithine carbamoyltransferase (ARG3),


LOCUS       XM_714078               1038 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_714078
VERSION     XM_714078.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1038)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1038)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1038)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1038)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1038)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1038)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1038
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1038
                     /gene="ARG3"
                     /locus_tag="CAALFM_C603230WA"
                     /db_xref="GeneID:3639180"
     CDS             1..1038
                     /gene="ARG3"
                     /locus_tag="CAALFM_C603230WA"
                     /note="Putative ornithine carbamoyltransferase;
                     Gcn4-regulated; Hap43-induced; repressed in alkalinizing
                     medium; rat catheter and Spider biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="ornithine carbamoyltransferase"
                     /protein_id="XP_719171.1"
                     /db_xref="CGD:CAL0000176534"
                     /db_xref="GeneID:3639180"
                     /translation="MMSSVRTITTTRLLSTTPIKATASSQTPRHLINIAQLTNDEFSS
                     LINKAYQFKQLVKSDKPSIENHQKLLGKLVALLFTKRSTRTRISTEGAASFFGAQPMF
                     LGKDDIQLGVNESMYDTTKVISSMTSCIFARVNKHQDILDLCQHSSVPIVNSLCDKYH
                     PLQAIADLLTIKEQFGDNLKGLKLTWIGDANNVINDLSIACLKLGINVSISIPKDITF
                     DQDVVEIAEKLAKEQNLTFEIVNDPIIALNNANIVVTDTWISMGEEEQKLAKLKQFQG
                     YQITQEMCKLGKVNSNWKFMHCLPRHQEEVADDVFYSDNSVVFEEAENRLYAAMAVID
                     GFVINKGDLLK"
     misc_feature    85..1011
                     /gene="ARG3"
                     /locus_tag="CAALFM_C603230WA"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
ORIGIN      
        1 atgatgtctt ccgttagaac tattactaca actagattat tatccactac tccaatcaaa
       61 gcaactgcgt cttcacaaac accacgtcat ttgatcaata tagctcaatt aaccaatgat
      121 gaattttctt cattgataaa taaagcttat caatttaaac aattggtcaa atcagataaa
      181 ccatcaattg aaaatcatca aaaattgtta ggtaaattag tggctttatt attcacaaaa
      241 agatctacta gaactagaat aagtactgaa ggagcggcat cattttttgg agctcaacca
      301 atgtttttag gtaaagatga tattcaatta ggtgttaatg aatcaatgta tgatacgaca
      361 aaagtgatta gttcaatgac gtcgtgtatt tttgctcgtg ttaacaaaca tcaagatatt
      421 ttagatttat gtcaacatag ttctgttcct attgtcaatt cattatgtga taaatatcat
      481 ccattacaag ccattgctga cttattaacc ataaaggaac aatttggtga taatttaaag
      541 gggttaaaat taacatggat tggtgatgct aataatgtta ttaatgattt atcgattgct
      601 tgtttgaaat taggtataaa tgtatctatt tcaataccta aagatattac atttgatcaa
      661 gatgtagttg aaatagctga aaaattagct aaggaacaaa atttgacatt tgaaattgtt
      721 aatgatccaa taattgcttt aaataatgct aatattgttg tcactgatac ttggatttct
      781 atgggtgaag aagaacaaaa attggctaaa ttgaaacaat ttcaaggtta tcaaattact
      841 caagaaatgt gtaaattggg taaagtcaat tcaaattgga aatttatgca ttgtttacca
      901 agacaccaag aagaagttgc tgatgatgtg ttttatagtg ataattcagt ggtttttgaa
      961 gaagctgaaa atagattata tgctgctatg gctgtgattg atggatttgt catcaataaa
     1021 ggtgacctct tgaaataa