Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_714078 1038 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_714078 VERSION XM_714078.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1038) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1038) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1038) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1038) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1038) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1038) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1038 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1038 /gene="ARG3" /locus_tag="CAALFM_C603230WA" /db_xref="GeneID:3639180" CDS 1..1038 /gene="ARG3" /locus_tag="CAALFM_C603230WA" /note="Putative ornithine carbamoyltransferase; Gcn4-regulated; Hap43-induced; repressed in alkalinizing medium; rat catheter and Spider biofilm induced" /codon_start=1 /transl_table=12 /product="ornithine carbamoyltransferase" /protein_id="XP_719171.1" /db_xref="CGD:CAL0000176534" /db_xref="GeneID:3639180" /translation="MMSSVRTITTTRLLSTTPIKATASSQTPRHLINIAQLTNDEFSS LINKAYQFKQLVKSDKPSIENHQKLLGKLVALLFTKRSTRTRISTEGAASFFGAQPMF LGKDDIQLGVNESMYDTTKVISSMTSCIFARVNKHQDILDLCQHSSVPIVNSLCDKYH PLQAIADLLTIKEQFGDNLKGLKLTWIGDANNVINDLSIACLKLGINVSISIPKDITF DQDVVEIAEKLAKEQNLTFEIVNDPIIALNNANIVVTDTWISMGEEEQKLAKLKQFQG YQITQEMCKLGKVNSNWKFMHCLPRHQEEVADDVFYSDNSVVFEEAENRLYAAMAVID GFVINKGDLLK" misc_feature 85..1011 /gene="ARG3" /locus_tag="CAALFM_C603230WA" /note="A large family of proteins that share a Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The NADB domain is found in numerous dehydrogenases of metabolic pathways such as glycolysis, and many other redox enzymes. NAD binding involves numerous...; Region: Rossmann-fold NAD(P)(+)-binding proteins; cl21454" /db_xref="CDD:473865" ORIGIN 1 atgatgtctt ccgttagaac tattactaca actagattat tatccactac tccaatcaaa 61 gcaactgcgt cttcacaaac accacgtcat ttgatcaata tagctcaatt aaccaatgat 121 gaattttctt cattgataaa taaagcttat caatttaaac aattggtcaa atcagataaa 181 ccatcaattg aaaatcatca aaaattgtta ggtaaattag tggctttatt attcacaaaa 241 agatctacta gaactagaat aagtactgaa ggagcggcat cattttttgg agctcaacca 301 atgtttttag gtaaagatga tattcaatta ggtgttaatg aatcaatgta tgatacgaca 361 aaagtgatta gttcaatgac gtcgtgtatt tttgctcgtg ttaacaaaca tcaagatatt 421 ttagatttat gtcaacatag ttctgttcct attgtcaatt cattatgtga taaatatcat 481 ccattacaag ccattgctga cttattaacc ataaaggaac aatttggtga taatttaaag 541 gggttaaaat taacatggat tggtgatgct aataatgtta ttaatgattt atcgattgct 601 tgtttgaaat taggtataaa tgtatctatt tcaataccta aagatattac atttgatcaa 661 gatgtagttg aaatagctga aaaattagct aaggaacaaa atttgacatt tgaaattgtt 721 aatgatccaa taattgcttt aaataatgct aatattgttg tcactgatac ttggatttct 781 atgggtgaag aagaacaaaa attggctaaa ttgaaacaat ttcaaggtta tcaaattact 841 caagaaatgt gtaaattggg taaagtcaat tcaaattgga aatttatgca ttgtttacca 901 agacaccaag aagaagttgc tgatgatgtg ttttatagtg ataattcagt ggtttttgaa 961 gaagctgaaa atagattata tgctgctatg gctgtgattg atggatttgt catcaataaa 1021 ggtgacctct tgaaataa