Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 uncharacterized protein (CAALFM_C603220WA),


LOCUS       XM_714077               1086 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_714077
VERSION     XM_714077.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1086)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1086)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1086)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1086)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1086)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1086)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1086
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1086
                     /locus_tag="CAALFM_C603220WA"
                     /db_xref="GeneID:3639179"
     CDS             1..1086
                     /locus_tag="CAALFM_C603220WA"
                     /note="Ortholog of C. dubliniensis CD36 : Cd36_63840, C.
                     parapsilosis CDC317 : CPAR2_601510, Debaryomyces hansenii
                     CBS767 : DEHA2A06270g and Pichia stipitis Pignal :
                     PICST_31363"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_719170.1"
                     /db_xref="CGD:CAL0000188314"
                     /db_xref="GeneID:3639179"
                     /translation="MNIEAEDDDDLLNELDHELKNTQTSKVSFKKKSFNKPQKIQRNK
                     LSFNIDDEEEDEEKEGHDGEKNNINELKPVPSKGASLLRFNPRTKFTKEKSSETEQPV
                     KKPINLSRYQIDTKTTTTTDNADQEIIPFELDEEDPENNPVITNIDDLNDEDNEEFAK
                     LKSKLIATTTTSQIFNHSEVLTSANKDTPKRYVPIETNRVPESSKLSIRQYTKALVNE
                     YKDDKNYDDGTERQNQEDQDLLLHDINDGDIELNDEDMGILNIGKRANFDDNKFNFEI
                     HSDDDDEKEESDDRLHSENESNDNGNIDFRIPTVEEQIMKINGLIKQLEVTKSEKQKL
                     VQNLKIERDELTETKSELLEKLNNLVI"
ORIGIN      
        1 atgaatattg aagcagaaga tgacgatgat ttattgaatg agttagacca tgaattgaaa
       61 aatacacaaa caagtaaagt tagtttcaaa aagaaatctt tcaacaagcc acaaaaaatc
      121 caacgaaaca aactactgtt caatattgat gatgaagagg aggatgaaga gaaggaggga
      181 catgatggag agaagaataa catcaatgag ctaaaacctg ttccaagcaa aggagcatcg
      241 ttacttcgat tcaacccacg aactaaattt acaaaagaaa aatcatcaga aacagaacaa
      301 ccagttaaaa aaccaatcaa tttatcaaga tatcaaattg acaccaagac cacaactact
      361 accgataatg ctgatcaaga aattatacca tttgagttgg atgaagagga tcctgaaaat
      421 aatccagtaa tcaccaatat agatgatctc aatgatgaag ataatgaaga gtttgctaaa
      481 ctaaaatcaa agctaattgc caccaccacc acatcacaaa tttttaatca ctctgaagtc
      541 ttaacttctg ctaataaaga tacaccaaaa cgatatgtac caatagaaac caatcgtgtt
      601 ccagaatccc tgaaattatc aattcgacaa tataccaagg ctttagtgaa cgaatataaa
      661 gatgacaaga attatgatga tggaacagaa cgacaaaacc aagaagatca agatctactt
      721 ttgcatgata tcaatgatgg cgatatagaa ttgaatgatg aagatatggg gatattaaat
      781 attggtaaac gtgctaattt tgacgacaat aagtttaatt ttgaaataca tagtgatgat
      841 gacgatgaaa aagaagaaag tgatgataga ctacatagtg agaatgagag taatgacaat
      901 ggtaatatag atttcaggat accaactgtt gaagaacaaa ttatgaaaat caacggatta
      961 attaaacaac ttgaagtcac aaaatcagaa aaacagaaac ttgttcaaaa tcttaagatt
     1021 gaacgagatg aattaaccga aacaaaactg gaactactag agaaattaaa taatttggtt
     1081 atttag