Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_714064 1134 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_714064 VERSION XM_714064.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1134) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1134) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1134) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1134) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1134) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1134) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_714064.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1134 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1134 /locus_tag="CAALFM_C603110CA" /db_xref="GeneID:3639278" CDS 1..1134 /locus_tag="CAALFM_C603110CA" /note="Ortholog(s) have ASTRA complex localization" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_719157.2" /db_xref="CGD:CAL0000191787" /db_xref="GeneID:3639278" /translation="MLSTKFTLRSHKSSVAYIYQDPRTPFNLFTADSSGLIINWDLTI RRPKKSWQAHTDTILTISTIHNHLLTHSRDNTIKIWDESYSCVLEIPCNALNFSNICI IYDLLITPASINSNNLDVYKIDKDWQITRLISDFDVYKLVNKGEIIEEIGSSGTSRND FGIIMQMKIIHTNTTTTTSENNSDYIIYVGFESGDIVGLQLILPRARILSTTGNTNDK TLINQSAKFILQYHNSTHVPNPVICLSNLDSVLVSGSTTNKVIIHSDPIEIMKMDHSG IQAIVNFKNDRLIFGYWNGYIQYGDISINQSLPKLGNTEQEKSKLTKKLTFMTILNES NQETLQSPTGKSKYLALLKSKRNLVFPLLLAGYEDGSILAYNI" misc_feature 13..>243 /locus_tag="CAALFM_C603110CA" /note="WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from...; Region: WD40; cl29593" /db_xref="CDD:475233" ORIGIN 1 atgttgtcta caaaattcac tctacggtca cataaatcat ccgtagcata tatctatcaa 61 gatccaagaa ctcctttcaa tcttttcacg gcagattctt ctgggttaat aatcaattgg 121 gatttaacaa tccgtcgacc taaaaaatca tggcaagctc atactgatac catacttacg 181 atatcaacaa ttcataatca tttattaacc cattctcgag ataataccat taagatatgg 241 gacgagtcgt atagctgtgt tttggaaata ccttgcaatg cattgaattt tagtaatatt 301 tgtattatat atgatttatt aattactcct gcaagtatca attctaataa tttggatgtt 361 tataaaatcg ataaagattg gcaaattaca agattaatat cggattttga tgtttataaa 421 ttagttaata aaggtgaaat aatagaagaa attggatctt ctggaaccag tcgtaatgat 481 tttggtataa taatgcaaat gaaaatcatc cacactaaca ccactaccac caccagtgag 541 aacaattctg attatatcat ttatgtgggc tttgaaagtg gtgatattgt agggctacag 601 ttgatattac cacgggcaag aatattatca actacaggaa acactaatga taaaaccctt 661 attaatcaat cagcgaaatt tattcttcaa tatcataatt caactcatgt ccctaatcca 721 gtgatttgtc tactgaatct agattcagtg ttagtatctg gatcaacaac taataaagtg 781 attattcata gtgatcccat tgaaataatg aaaatggatc attcaggaat tcaagcaatt 841 gttaacttta agaatgatcg attaattttt ggatattgga atggatatat tcaatatggt 901 gatatatcaa ttaatcaaag tttaccaaaa ttaggcaaca ctgaacaaga aaaatcgaaa 961 ttaacaaaaa aattaacctt catgactatt ttgaacgaat caaaccaaga gacattacaa 1021 tctcctactg gtaaatccaa atatttggca cttttgaaat caaaaagaaa ccttgtattt 1081 cctcttttat tagcaggata tgaagatggt tcaatacttg cttacaatat atag