Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 uncharacterized protein (CAALFM_C603110CA),


LOCUS       XM_714064               1134 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_714064
VERSION     XM_714064.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1134)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1134)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1134)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1134)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1134)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1134)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_714064.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1134
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1134
                     /locus_tag="CAALFM_C603110CA"
                     /db_xref="GeneID:3639278"
     CDS             1..1134
                     /locus_tag="CAALFM_C603110CA"
                     /note="Ortholog(s) have ASTRA complex localization"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_719157.2"
                     /db_xref="CGD:CAL0000191787"
                     /db_xref="GeneID:3639278"
                     /translation="MLSTKFTLRSHKSSVAYIYQDPRTPFNLFTADSSGLIINWDLTI
                     RRPKKSWQAHTDTILTISTIHNHLLTHSRDNTIKIWDESYSCVLEIPCNALNFSNICI
                     IYDLLITPASINSNNLDVYKIDKDWQITRLISDFDVYKLVNKGEIIEEIGSSGTSRND
                     FGIIMQMKIIHTNTTTTTSENNSDYIIYVGFESGDIVGLQLILPRARILSTTGNTNDK
                     TLINQSAKFILQYHNSTHVPNPVICLSNLDSVLVSGSTTNKVIIHSDPIEIMKMDHSG
                     IQAIVNFKNDRLIFGYWNGYIQYGDISINQSLPKLGNTEQEKSKLTKKLTFMTILNES
                     NQETLQSPTGKSKYLALLKSKRNLVFPLLLAGYEDGSILAYNI"
     misc_feature    13..>243
                     /locus_tag="CAALFM_C603110CA"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cl29593"
                     /db_xref="CDD:475233"
ORIGIN      
        1 atgttgtcta caaaattcac tctacggtca cataaatcat ccgtagcata tatctatcaa
       61 gatccaagaa ctcctttcaa tcttttcacg gcagattctt ctgggttaat aatcaattgg
      121 gatttaacaa tccgtcgacc taaaaaatca tggcaagctc atactgatac catacttacg
      181 atatcaacaa ttcataatca tttattaacc cattctcgag ataataccat taagatatgg
      241 gacgagtcgt atagctgtgt tttggaaata ccttgcaatg cattgaattt tagtaatatt
      301 tgtattatat atgatttatt aattactcct gcaagtatca attctaataa tttggatgtt
      361 tataaaatcg ataaagattg gcaaattaca agattaatat cggattttga tgtttataaa
      421 ttagttaata aaggtgaaat aatagaagaa attggatctt ctggaaccag tcgtaatgat
      481 tttggtataa taatgcaaat gaaaatcatc cacactaaca ccactaccac caccagtgag
      541 aacaattctg attatatcat ttatgtgggc tttgaaagtg gtgatattgt agggctacag
      601 ttgatattac cacgggcaag aatattatca actacaggaa acactaatga taaaaccctt
      661 attaatcaat cagcgaaatt tattcttcaa tatcataatt caactcatgt ccctaatcca
      721 gtgatttgtc tactgaatct agattcagtg ttagtatctg gatcaacaac taataaagtg
      781 attattcata gtgatcccat tgaaataatg aaaatggatc attcaggaat tcaagcaatt
      841 gttaacttta agaatgatcg attaattttt ggatattgga atggatatat tcaatatggt
      901 gatatatcaa ttaatcaaag tttaccaaaa ttaggcaaca ctgaacaaga aaaatcgaaa
      961 ttaacaaaaa aattaacctt catgactatt ttgaacgaat caaaccaaga gacattacaa
     1021 tctcctactg gtaaatccaa atatttggca cttttgaaat caaaaagaaa ccttgtattt
     1081 cctcttttat tagcaggata tgaagatggt tcaatacttg cttacaatat atag