Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 putative cysteine synthase


LOCUS       XM_714043               1197 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C602960WA), partial mRNA.
ACCESSION   XM_714043
VERSION     XM_714043.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 1197)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 1197)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 1197)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 1197)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1197)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 1197)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_714043.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1197
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>1197
                     /locus_tag="CAALFM_C602960WA"
                     /db_xref="GeneID:3639189"
     CDS             1..1197
                     /locus_tag="CAALFM_C602960WA"
                     /note="Ortholog(s) have mitochondrial outer membrane
                     localization"
                     /codon_start=1
                     /transl_table=12
                     /product="putative cysteine synthase"
                     /protein_id="XP_719136.2"
                     /db_xref="CGD:CAL0000195320"
                     /db_xref="GeneID:3639189"
                     /translation="MAINWKSTLQTSASVISLFLIAKELYNLYVTTTNKDKSNSKLTL
                     LPPRTRGIESLIGNTPLIEIKSLSRQLGCKIYAKLELCNPGGSAKDRVALAIIRAGES
                     SGQLIPNANNIIFEGTSGSTGISLAILCNALGYICHICLPDDTSLEKLQLLKSLGAEL
                     EPVKPASIVDPNQYTNAARRGALAVNQNRDGHSQRRAIFADQFENDFNWRIHYETTGP
                     ELLQQMGQDKIDVFINGSGTGGTIAGVGRCLKEYNPRTKIVLADPQGSGLANRINYGV
                     MYDSVEKEGTRRRHQVDTLVEGIGLNRLTWNFKQAEPYIDEAIRVTDDQALKMAKYLS
                     INDGLFLGSSSAINCVAAVKMALKNGPGQKIVVIACDSGARHLSKFWKEAAKLPNDLT
                     LDDILQ"
     misc_feature    31..1140
                     /locus_tag="CAALFM_C602960WA"
                     /note="Tryptophan synthase beta superfamily (fold type
                     II); this family of pyridoxal phosphate (PLP)-dependent
                     enzymes catalyzes beta-replacement and beta-elimination
                     reactions. This CD corresponds to
                     aminocyclopropane-1-carboxylate deaminase (ACCD),
                     tryptophan...; Region: Trp-synth-beta_II; cl00342"
                     /db_xref="CDD:444852"
     misc_feature    order(181..189,226..228,244..246,250..252,382..384,
                     391..393,439..444,451..456,463..468,664..669,1000..1008,
                     1012..1020,1090..1092,1120..1122,1129..1131)
                     /locus_tag="CAALFM_C602960WA"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    order(265..267,361..363,706..723,892..894,1030..1032,
                     1108..1113)
                     /locus_tag="CAALFM_C602960WA"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    265..267
                     /locus_tag="CAALFM_C602960WA"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107204"
ORIGIN      
        1 atggcaatta attggaaatc aacattacaa acctcggcat cagtgatatc attatttctt
       61 attgccaaag aattatataa cttatatgtt accactacca acaaagataa atcaaattct
      121 aaactaacat tattaccacc acgaactcga ggcatcgaat cattaattgg taatactccc
      181 ttaattgaaa taaaatcatt atcacgtcaa ttaggttgta aaatatatgc taaattagaa
      241 ctttgtaatc ctggaggaag tgcaaaagat cgagtagcat tagctataat tcgagctggg
      301 gaatcatcag gtcaattaat ccctaatgcg aataatatta tatttgaagg tactagtgga
      361 tctacaggaa tatcattagc tatattatgt aatgccttag ggtatatttg tcatatttgt
      421 ttacctgatg atacatcttt agaaaaatta caattattga aatcattagg tgcagaatta
      481 gaaccagtta aaccggcaag tatagtagat cctaatcaat ataccaatgc tgctcgacgt
      541 ggtgcattag ccgtgaatca aaatagagat ggtcattctc aacgacgagc aatatttgct
      601 gatcaatttg aaaatgattt taattggaga attcattatg aaactacagg accagagtta
      661 ttacaacaaa tgggtcaaga taaaatcgat gtatttataa atggtagtgg tactggtgga
      721 accattgctg gtgttgggag atgtttaaaa gaatataatc caagaacaaa aattgtttta
      781 gctgatcctc aaggttctgg gttagctaat agaattaatt atggagttat gtatgattct
      841 gttgagaaag aggggacaag aagacgacat caagttgata cattagttga aggaattgga
      901 ttaaatcgat tgacttggaa ttttaaacaa gctgaaccat atattgatga agctattaga
      961 gtcactgatg atcaagcatt aaaaatggca aaatatttaa gtattaatga tggattattt
     1021 ttagggagtt catcagcgat aaattgtgtt gctgctgtga aaatggcatt gaaaaatggt
     1081 cctggtcaaa aaattgttgt tattgcttgt gattctggtg ctagacattt atctaaattt
     1141 tggaaagaag ctgcaaaatt acccaatgat cttacattag atgatatact acaataa