Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_714043 1197 bp mRNA linear PLN 18-APR-2022 (CAALFM_C602960WA), partial mRNA. ACCESSION XM_714043 VERSION XM_714043.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 1197) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 1197) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 1197) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 1197) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1197) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 1197) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_714043.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1197 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>1197 /locus_tag="CAALFM_C602960WA" /db_xref="GeneID:3639189" CDS 1..1197 /locus_tag="CAALFM_C602960WA" /note="Ortholog(s) have mitochondrial outer membrane localization" /codon_start=1 /transl_table=12 /product="putative cysteine synthase" /protein_id="XP_719136.2" /db_xref="CGD:CAL0000195320" /db_xref="GeneID:3639189" /translation="MAINWKSTLQTSASVISLFLIAKELYNLYVTTTNKDKSNSKLTL LPPRTRGIESLIGNTPLIEIKSLSRQLGCKIYAKLELCNPGGSAKDRVALAIIRAGES SGQLIPNANNIIFEGTSGSTGISLAILCNALGYICHICLPDDTSLEKLQLLKSLGAEL EPVKPASIVDPNQYTNAARRGALAVNQNRDGHSQRRAIFADQFENDFNWRIHYETTGP ELLQQMGQDKIDVFINGSGTGGTIAGVGRCLKEYNPRTKIVLADPQGSGLANRINYGV MYDSVEKEGTRRRHQVDTLVEGIGLNRLTWNFKQAEPYIDEAIRVTDDQALKMAKYLS INDGLFLGSSSAINCVAAVKMALKNGPGQKIVVIACDSGARHLSKFWKEAAKLPNDLT LDDILQ" misc_feature 31..1140 /locus_tag="CAALFM_C602960WA" /note="Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions. This CD corresponds to aminocyclopropane-1-carboxylate deaminase (ACCD), tryptophan...; Region: Trp-synth-beta_II; cl00342" /db_xref="CDD:444852" misc_feature order(181..189,226..228,244..246,250..252,382..384, 391..393,439..444,451..456,463..468,664..669,1000..1008, 1012..1020,1090..1092,1120..1122,1129..1131) /locus_tag="CAALFM_C602960WA" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:107204" misc_feature order(265..267,361..363,706..723,892..894,1030..1032, 1108..1113) /locus_tag="CAALFM_C602960WA" /note="pyridoxal 5'-phosphate binding site [chemical binding]; other site" /db_xref="CDD:107204" misc_feature 265..267 /locus_tag="CAALFM_C602960WA" /note="catalytic residue [active]" /db_xref="CDD:107204" ORIGIN 1 atggcaatta attggaaatc aacattacaa acctcggcat cagtgatatc attatttctt 61 attgccaaag aattatataa cttatatgtt accactacca acaaagataa atcaaattct 121 aaactaacat tattaccacc acgaactcga ggcatcgaat cattaattgg taatactccc 181 ttaattgaaa taaaatcatt atcacgtcaa ttaggttgta aaatatatgc taaattagaa 241 ctttgtaatc ctggaggaag tgcaaaagat cgagtagcat tagctataat tcgagctggg 301 gaatcatcag gtcaattaat ccctaatgcg aataatatta tatttgaagg tactagtgga 361 tctacaggaa tatcattagc tatattatgt aatgccttag ggtatatttg tcatatttgt 421 ttacctgatg atacatcttt agaaaaatta caattattga aatcattagg tgcagaatta 481 gaaccagtta aaccggcaag tatagtagat cctaatcaat ataccaatgc tgctcgacgt 541 ggtgcattag ccgtgaatca aaatagagat ggtcattctc aacgacgagc aatatttgct 601 gatcaatttg aaaatgattt taattggaga attcattatg aaactacagg accagagtta 661 ttacaacaaa tgggtcaaga taaaatcgat gtatttataa atggtagtgg tactggtgga 721 accattgctg gtgttgggag atgtttaaaa gaatataatc caagaacaaa aattgtttta 781 gctgatcctc aaggttctgg gttagctaat agaattaatt atggagttat gtatgattct 841 gttgagaaag aggggacaag aagacgacat caagttgata cattagttga aggaattgga 901 ttaaatcgat tgacttggaa ttttaaacaa gctgaaccat atattgatga agctattaga 961 gtcactgatg atcaagcatt aaaaatggca aaatatttaa gtattaatga tggattattt 1021 ttagggagtt catcagcgat aaattgtgtt gctgctgtga aaatggcatt gaaaaatggt 1081 cctggtcaaa aaattgttgt tattgcttgt gattctggtg ctagacattt atctaaattt 1141 tggaaagaag ctgcaaaatt acccaatgat cttacattag atgatatact acaataa