Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_714033 699 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_714033 VERSION XM_714033.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 699) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 699) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 699) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 699) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 699) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 699) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_714033.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..699 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>699 /locus_tag="CAALFM_C602880WA" /db_xref="GeneID:3639238" CDS 1..699 /locus_tag="CAALFM_C602880WA" /note="Has domain(s) with predicted RNA-DNA hybrid ribonuclease activity, nucleic acid binding activity" /codon_start=1 /transl_table=12 /product="uncharacterized protein" /protein_id="XP_719126.2" /db_xref="CGD:CAL0000184579" /db_xref="GeneID:3639238" /translation="MPYYAVARGREVGIYSSWRECRPQVYCCKGARYRKFENLIEAKE YCENDGRYYIYPVYVDGACRNNGRENAKGGYGVYYGDEDPRNVSVPLDRVDPNGIRPT NQRAELWAMNHALKNILNELQDETEKGKAIIYSDSIYAINCLTKWPEKWIYNGWQNSR GRTISNQELIEENYDLYESINEEYDDRDWGSLRFVHVKGHSGVEGNEEADRLANLAVD EYGQRSIFRSIFGF" misc_feature 4..135 /locus_tag="CAALFM_C602880WA" /note="Caulimovirus viroplasmin; Region: Cauli_VI; pfam01693" /db_xref="CDD:460297" misc_feature 169..654 /locus_tag="CAALFM_C602880WA" /note="Eukaryotic RNase H is essential and is longer and more complex than their prokaryotic counterparts; Region: RNase_HI_eukaryote_like; cd09280" /db_xref="CDD:260012" misc_feature order(178..189,193..201,304..312,319..321,406..408, 412..417,493..498,586..588,595..597,640..642) /locus_tag="CAALFM_C602880WA" /note="RNA/DNA hybrid binding site [nucleotide binding]; other site" /db_xref="CDD:260012" ORIGIN 1 atgccttatt acgctgttgc taggggacgc gaagtgggta tttattcgag ttggagagaa 61 tgtcggccac aagtatattg ttgtaaagga gctcgttata ggaaatttga gaacttgatt 121 gaagcaaaag aatattgtga aaacgacgga cgatactaca tttatccagt atacgtcgat 181 ggagcatgca gaaataatgg acgtgaaaac gccaagggtg gatatggagt ttactatggg 241 gatgaagacc caagaaatgt atcagtacct ttagatcggg ttgatcctaa tggaattcgt 301 cctactaatc aacgtgctga attgtgggcc atgaaccatg ctttgaaaaa cattttgaac 361 gaattacaag acgaaactga gaagggaaaa gctattattt atagtgattc aatttatgcc 421 atcaattgtc ttactaaatg gccggaaaaa tggatttaca atggatggca aaatagtcga 481 ggtcgtacaa tttccaatca agaattaatt gaagagaatt atgacttgta tgagctgatt 541 aatgaggaat acgatgacag agattggggg agcttacgtt ttgttcatgt aaagggtcat 601 tctggtgtgg agggaaatga agaagctgat agattggcca acttagctgt tgatgaatat 661 ggtcaaagat ccatttttcg ttcaattttt ggattttaa