Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 uncharacterized protein (CAALFM_C602880WA),


LOCUS       XM_714033                699 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_714033
VERSION     XM_714033.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 699)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 699)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 699)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 699)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 699)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 699)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_714033.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..699
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>699
                     /locus_tag="CAALFM_C602880WA"
                     /db_xref="GeneID:3639238"
     CDS             1..699
                     /locus_tag="CAALFM_C602880WA"
                     /note="Has domain(s) with predicted RNA-DNA hybrid
                     ribonuclease activity, nucleic acid binding activity"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_719126.2"
                     /db_xref="CGD:CAL0000184579"
                     /db_xref="GeneID:3639238"
                     /translation="MPYYAVARGREVGIYSSWRECRPQVYCCKGARYRKFENLIEAKE
                     YCENDGRYYIYPVYVDGACRNNGRENAKGGYGVYYGDEDPRNVSVPLDRVDPNGIRPT
                     NQRAELWAMNHALKNILNELQDETEKGKAIIYSDSIYAINCLTKWPEKWIYNGWQNSR
                     GRTISNQELIEENYDLYESINEEYDDRDWGSLRFVHVKGHSGVEGNEEADRLANLAVD
                     EYGQRSIFRSIFGF"
     misc_feature    4..135
                     /locus_tag="CAALFM_C602880WA"
                     /note="Caulimovirus viroplasmin; Region: Cauli_VI;
                     pfam01693"
                     /db_xref="CDD:460297"
     misc_feature    169..654
                     /locus_tag="CAALFM_C602880WA"
                     /note="Eukaryotic RNase H is essential and is longer and
                     more complex than their prokaryotic counterparts; Region:
                     RNase_HI_eukaryote_like; cd09280"
                     /db_xref="CDD:260012"
     misc_feature    order(178..189,193..201,304..312,319..321,406..408,
                     412..417,493..498,586..588,595..597,640..642)
                     /locus_tag="CAALFM_C602880WA"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:260012"
ORIGIN      
        1 atgccttatt acgctgttgc taggggacgc gaagtgggta tttattcgag ttggagagaa
       61 tgtcggccac aagtatattg ttgtaaagga gctcgttata ggaaatttga gaacttgatt
      121 gaagcaaaag aatattgtga aaacgacgga cgatactaca tttatccagt atacgtcgat
      181 ggagcatgca gaaataatgg acgtgaaaac gccaagggtg gatatggagt ttactatggg
      241 gatgaagacc caagaaatgt atcagtacct ttagatcggg ttgatcctaa tggaattcgt
      301 cctactaatc aacgtgctga attgtgggcc atgaaccatg ctttgaaaaa cattttgaac
      361 gaattacaag acgaaactga gaagggaaaa gctattattt atagtgattc aatttatgcc
      421 atcaattgtc ttactaaatg gccggaaaaa tggatttaca atggatggca aaatagtcga
      481 ggtcgtacaa tttccaatca agaattaatt gaagagaatt atgacttgta tgagctgatt
      541 aatgaggaat acgatgacag agattggggg agcttacgtt ttgttcatgt aaagggtcat
      601 tctggtgtgg agggaaatga agaagctgat agattggcca acttagctgt tgatgaatat
      661 ggtcaaagat ccatttttcg ttcaattttt ggattttaa