Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 L-methionine (R)-S-oxide reductase


LOCUS       XM_714023                528 bp    mRNA    linear   PLN 18-APR-2022
            (CAALFM_C602800WA), partial mRNA.
ACCESSION   XM_714023
VERSION     XM_714023.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 528)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 528)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 528)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 528)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 528)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 528)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_714023.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..528
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>528
                     /locus_tag="CAALFM_C602800WA"
                     /db_xref="GeneID:3639246"
     CDS             1..528
                     /locus_tag="CAALFM_C602800WA"
                     /note="Ortholog(s) have methionine-R-sulfoxide reductase
                     activity, role in cellular response to oxidative stress
                     and cytoplasm, nucleus localization"
                     /codon_start=1
                     /transl_table=12
                     /product="L-methionine (R)-S-oxide reductase"
                     /protein_id="XP_719116.2"
                     /db_xref="CGD:CAL0000182985"
                     /db_xref="GeneID:3639246"
                     /translation="MVHADYSNLKSGDFSKEETLQHVLDSYKALETDNWVANLSNCSS
                     LLWHAYKSLNINVNWTGFYLTVENKNEGQTSPTELILGPFQGKVACQLIKFGHGVCGT
                     AASKKLTQLVPDVEKFPGHIACDGETKSEIVVPIVKNGETKGVIDLDCLDLEGFDKVD
                     QEYLEKLAELIAQSL"
     misc_feature    43..525
                     /locus_tag="CAALFM_C602800WA"
                     /note="GAF domain-containing protein, putative
                     methionine-R-sulfoxide reductase [Defense mechanisms,
                     Signal transduction mechanisms]; Region: MsrC; COG1956"
                     /db_xref="CDD:441559"
ORIGIN      
        1 atggtgcacg ctgattattc aaatctcaaa tctggagact tttccaaaga agaaaccctc
       61 caacacgttc tagattccta caaagcatta gaaaccgaca attgggtagc aaacttatcc
      121 aattgctcat cattattatg gcatgcgtac aaatcattaa atattaacgt caattggact
      181 ggattttacc ttacagttga aaacaaaaac gaaggtcaaa cctcacctac tgaattaatt
      241 ttgggcccat ttcaaggtaa agttgcatgt cagttgatta aatttggtca tggtgtttgt
      301 ggaactgctg cgtcgaaaaa attgacacaa ctagtacctg atgtagaaaa attccctggt
      361 catattgcct gtgatggaga aaccaaaagt gaaatagttg ttcctattgt gaaaaatggt
      421 gaaaccaagg gagtaattga tttggattgt ttagatcttg aagggtttga taaggtcgat
      481 caagaatatt tggaaaaatt agctgaatta attgctcaat ctttgtaa