Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_714023 528 bp mRNA linear PLN 18-APR-2022 (CAALFM_C602800WA), partial mRNA. ACCESSION XM_714023 VERSION XM_714023.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 528) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 528) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 528) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 528) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 528) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 528) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_714023.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..528 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>528 /locus_tag="CAALFM_C602800WA" /db_xref="GeneID:3639246" CDS 1..528 /locus_tag="CAALFM_C602800WA" /note="Ortholog(s) have methionine-R-sulfoxide reductase activity, role in cellular response to oxidative stress and cytoplasm, nucleus localization" /codon_start=1 /transl_table=12 /product="L-methionine (R)-S-oxide reductase" /protein_id="XP_719116.2" /db_xref="CGD:CAL0000182985" /db_xref="GeneID:3639246" /translation="MVHADYSNLKSGDFSKEETLQHVLDSYKALETDNWVANLSNCSS LLWHAYKSLNINVNWTGFYLTVENKNEGQTSPTELILGPFQGKVACQLIKFGHGVCGT AASKKLTQLVPDVEKFPGHIACDGETKSEIVVPIVKNGETKGVIDLDCLDLEGFDKVD QEYLEKLAELIAQSL" misc_feature 43..525 /locus_tag="CAALFM_C602800WA" /note="GAF domain-containing protein, putative methionine-R-sulfoxide reductase [Defense mechanisms, Signal transduction mechanisms]; Region: MsrC; COG1956" /db_xref="CDD:441559" ORIGIN 1 atggtgcacg ctgattattc aaatctcaaa tctggagact tttccaaaga agaaaccctc 61 caacacgttc tagattccta caaagcatta gaaaccgaca attgggtagc aaacttatcc 121 aattgctcat cattattatg gcatgcgtac aaatcattaa atattaacgt caattggact 181 ggattttacc ttacagttga aaacaaaaac gaaggtcaaa cctcacctac tgaattaatt 241 ttgggcccat ttcaaggtaa agttgcatgt cagttgatta aatttggtca tggtgtttgt 301 ggaactgctg cgtcgaaaaa attgacacaa ctagtacctg atgtagaaaa attccctggt 361 catattgcct gtgatggaga aaccaaaagt gaaatagttg ttcctattgt gaaaaatggt 421 gaaaccaagg gagtaattga tttggattgt ttagatcttg aagggtttga taaggtcgat 481 caagaatatt tggaaaaatt agctgaatta attgctcaat ctttgtaa