Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 Mrt4p (MRT4), partial mRNA.


LOCUS       XM_714020                693 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_714020
VERSION     XM_714020.2
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 693)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 693)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 693)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 693)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 693)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 693)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            On Dec 8, 2016 this sequence version replaced XM_714020.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..693
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>693
                     /gene="MRT4"
                     /locus_tag="CAALFM_C602770WA"
                     /db_xref="GeneID:3639219"
     CDS             1..693
                     /gene="MRT4"
                     /locus_tag="CAALFM_C602770WA"
                     /note="Putative mRNA turnover protein; Hap43-induced;
                     mutation confers hypersensitivity to tubercidin
                     (7-deazaadenosine); rat catheter biofilm induced"
                     /codon_start=1
                     /transl_table=12
                     /product="Mrt4p"
                     /protein_id="XP_719113.1"
                     /db_xref="CGD:CAL0000181896"
                     /db_xref="GeneID:3639219"
                     /translation="MPRSKRSKLVTLAQTEKKGKENKTRLFDEVRSALDTFKYIWVLQ
                     FDDIRTPVLQDVRNDWVGSKLILGKRKVLQKALGETIEEEYKDNLHQLSKLCEGLPGL
                     LFTDESPETVEAYFKAYSKQDYSRAKSRAPIDFTIPAGIVYSRGGQISIEEDVPMSHS
                     LEETLRNKLKVPTKIKAGKIILEEPYVVCNKGDVLDTRQALLLKQFGVAASEFKIPIL
                     GYYDGEVHKYDN"
     misc_feature    61..588
                     /gene="MRT4"
                     /locus_tag="CAALFM_C602770WA"
                     /note="Ribosomal protein L10 family, P0-like protein
                     subfamily; composed of uncharacterized eukaryotic proteins
                     with similarity to the 60S ribosomal protein P0, including
                     the Saccharomyces cerevisiae protein called mRNA turnover
                     protein 4 (MRT4). MRT4 may be...; Region:
                     Ribosomal_P0_like; cd05796"
                     /db_xref="CDD:240222"
     misc_feature    order(67..72,79..81,205..216,223..225)
                     /gene="MRT4"
                     /locus_tag="CAALFM_C602770WA"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:240222"
     misc_feature    order(328..330,388..390,400..402,490..492,502..507,
                     514..519,523..534,541..549,556..561,565..570,574..576)
                     /gene="MRT4"
                     /locus_tag="CAALFM_C602770WA"
                     /note="putative Interface with L7/L12 ribosomal proteins
                     [polypeptide binding]; other site"
                     /db_xref="CDD:240222"
ORIGIN      
        1 atgcctagat caaaacgttc gaaacttgtt actttagcac agactgaaaa gaaggggaaa
       61 gaaaacaaga ctcgtttatt tgatgaagtt agatctgcat tagatacttt taaatatata
      121 tgggttttac aatttgatga tattagaact ccagtattac aagatgttag aaatgattgg
      181 gttggatcaa aattgatttt aggtaaaaga aaagtattac aaaaggcatt aggtgaaacc
      241 attgaagaag aatataaaga caatttacat caattatcta aattatgtga aggtttacca
      301 ggattattat ttactgatga atcaccagaa actgttgaag cttatttcaa agcatattcc
      361 aaacaagatt attctagagc caaatctaga gcaccaatag attttactat acctgcaggg
      421 attgtttatt ctagaggtgg acaaatttcc atagaagaag atgttccaat gtcacattct
      481 ttagaagaaa ctttaagaaa caaattaaaa gttccaacta aaatcaaagc cggtaaaatt
      541 attcttgaag aaccttatgt tgtttgtaat aaaggtgatg ttttagatac tagacaagct
      601 ttgttattga aacaatttgg tgttgctgcg agtgaattta aaattcctat tcttggttat
      661 tatgatggag aagtacataa atatgataat taa