Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_714020 693 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_714020 VERSION XM_714020.2 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 693) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 693) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 693) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 693) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 693) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 693) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). On Dec 8, 2016 this sequence version replaced XM_714020.1. ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..693 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>693 /gene="MRT4" /locus_tag="CAALFM_C602770WA" /db_xref="GeneID:3639219" CDS 1..693 /gene="MRT4" /locus_tag="CAALFM_C602770WA" /note="Putative mRNA turnover protein; Hap43-induced; mutation confers hypersensitivity to tubercidin (7-deazaadenosine); rat catheter biofilm induced" /codon_start=1 /transl_table=12 /product="Mrt4p" /protein_id="XP_719113.1" /db_xref="CGD:CAL0000181896" /db_xref="GeneID:3639219" /translation="MPRSKRSKLVTLAQTEKKGKENKTRLFDEVRSALDTFKYIWVLQ FDDIRTPVLQDVRNDWVGSKLILGKRKVLQKALGETIEEEYKDNLHQLSKLCEGLPGL LFTDESPETVEAYFKAYSKQDYSRAKSRAPIDFTIPAGIVYSRGGQISIEEDVPMSHS LEETLRNKLKVPTKIKAGKIILEEPYVVCNKGDVLDTRQALLLKQFGVAASEFKIPIL GYYDGEVHKYDN" misc_feature 61..588 /gene="MRT4" /locus_tag="CAALFM_C602770WA" /note="Ribosomal protein L10 family, P0-like protein subfamily; composed of uncharacterized eukaryotic proteins with similarity to the 60S ribosomal protein P0, including the Saccharomyces cerevisiae protein called mRNA turnover protein 4 (MRT4). MRT4 may be...; Region: Ribosomal_P0_like; cd05796" /db_xref="CDD:240222" misc_feature order(67..72,79..81,205..216,223..225) /gene="MRT4" /locus_tag="CAALFM_C602770WA" /note="23S rRNA interface [nucleotide binding]; other site" /db_xref="CDD:240222" misc_feature order(328..330,388..390,400..402,490..492,502..507, 514..519,523..534,541..549,556..561,565..570,574..576) /gene="MRT4" /locus_tag="CAALFM_C602770WA" /note="putative Interface with L7/L12 ribosomal proteins [polypeptide binding]; other site" /db_xref="CDD:240222" ORIGIN 1 atgcctagat caaaacgttc gaaacttgtt actttagcac agactgaaaa gaaggggaaa 61 gaaaacaaga ctcgtttatt tgatgaagtt agatctgcat tagatacttt taaatatata 121 tgggttttac aatttgatga tattagaact ccagtattac aagatgttag aaatgattgg 181 gttggatcaa aattgatttt aggtaaaaga aaagtattac aaaaggcatt aggtgaaacc 241 attgaagaag aatataaaga caatttacat caattatcta aattatgtga aggtttacca 301 ggattattat ttactgatga atcaccagaa actgttgaag cttatttcaa agcatattcc 361 aaacaagatt attctagagc caaatctaga gcaccaatag attttactat acctgcaggg 421 attgtttatt ctagaggtgg acaaatttcc atagaagaag atgttccaat gtcacattct 481 ttagaagaaa ctttaagaaa caaattaaaa gttccaacta aaatcaaagc cggtaaaatt 541 attcttgaag aaccttatgt tgtttgtaat aaaggtgatg ttttagatac tagacaagct 601 ttgttattga aacaatttgg tgttgctgcg agtgaattta aaattcctat tcttggttat 661 tatgatggag aagtacataa atatgataat taa